KEGG   Rattus norvegicus (rat): 25052Help
Entry
25052             CDS       T01003                                 

Gene name
Prss2, Ptryss2
Definition
(RefSeq) protease, serine, 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04972  Pancreatic secretion
rno04974  Protein digestion and absorption
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25052 (Prss2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    25052 (Prss2)
   04974 Protein digestion and absorption
    25052 (Prss2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    25052 (Prss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    25052 (Prss2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25052 (Prss2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     25052 (Prss2)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   25052 (Prss2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25052 (Prss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 25052
NCBI-ProteinID: NP_036861
RGD: 3418
Ensembl: ENSRNOG00000032916
UniProt: P00763
LinkDB All DBs
Structure
PDB: 

Position
4q23
AA seq 246 aa AA seqDB search
MRALLFLALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVS
AAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLN
ARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKIT
DNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQ
DTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagagcactcctgttcctggctcttgtgggagctgctgttgcttttcccgtggatgat
gatgacaagatcgttggaggatacacctgccaagagaattctgttccctaccaagtgtcc
ctgaactctggctaccacttctgtggaggttccctcatcaatgaccagtgggtggtgtct
gcagctcactgctataagtcccgcatccaagtgagactgggagagcacaacatcaatgtc
cttgagggcaatgagcagtttgtcaatgctgccaagatcatcaagcatcccaacttcgat
aggaagaccctgaacaatgacatcatgctgatcaagctctcttcccctgtgaaactcaat
gctcgagtggccactgtggctcttcccagctcctgtgcacctgcaggcactcagtgcctc
atctctggctggggcaacacgctcagcagtggcgtcaatgaaccagacctgctccagtgc
ctggatgccccactgctgccccaagctgactgtgaagcctcctaccctggaaagatcact
gacaacatggtctgtgttggcttcctagagggaggcaaggattcctgccagggtgactct
ggtggccctgtggtctgtaatggagagctgcagggcattgtctcctggggctatggctgt
gccctgccagataaccctggtgtgtacaccaaggtctgcaactatgtggactggattcag
gacacaattgctgccaactag

DBGET integrated database retrieval system