KEGG   Rattus norvegicus (rat): 25058Help
Entry
25058             CDS       T01003                                 

Gene name
Hk1, HEXOKIN, HKI
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno00524  Neomycin, kanamycin and gentamicin biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04910  Insulin signaling pathway
rno04930  Type II diabetes mellitus
rno04973  Carbohydrate digestion and absorption
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25058 (Hk1)
   00051 Fructose and mannose metabolism
    25058 (Hk1)
   00052 Galactose metabolism
    25058 (Hk1)
   00500 Starch and sucrose metabolism
    25058 (Hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    25058 (Hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    25058 (Hk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    25058 (Hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25058 (Hk1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    25058 (Hk1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    25058 (Hk1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    25058 (Hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25058 (Hk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     25058 (Hk1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    25058 (Hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 25058
NCBI-ProteinID: NP_036866
RGD: 2796
UniProt: P05708
LinkDB All DBs
Structure
PDB: 

Position
20q11
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTAS
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVSMESEIYDTPENIVH
GSGTQLFDHVADCLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKDKEGIQNAKEILTRLG
VEPSDVDCVSVQHICTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMH
PQYSRRFHKTLRRLVPDSDVRFLLSESGTGKGAAMVTAVAYRLAEQHRQIEETLAHFRLS
KQTLMEVKKRLRTEMEMGLRKETNSKATVKMLPSFVRSIPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCHQTNLDCGILISWTKGFKATDCEGHDVASLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIVGTGTNACYMEEMKNVEMVEGNQGQMCINMEWGAFGDNGCLDD
IRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKG
AALITAVGVRLRGDPSIA
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcaactactggcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgacaagtatctgtacgccatgcggctctctgatgagattctgatagatatcctg
acacgattcaagaaagagatgaagaatggcctctcccgggattataatccaacagcctcc
gtcaagatgctgcccaccttcgtccggtccattccggacggctcagaaaagggggatttc
attgccctggatctcggcgggtcttcctttcgaatcctgcgggtgcaggtgaaccacgag
aagaaccagaacgtcagcatggagtctgagatctacgacaccccagagaacatcgtgcat
ggcagtggaacccagcttttcgatcatgtcgctgactgcctgggagacttcatggagaaa
aagaagatcaaggacaagaagttacccgtgggattcacattttccttcccctgccgacaa
tccaagatagatgaggctgtactgatcacgtggacaaagcggttcaaagccagtggcgtg
gaaggagcggatgtggtcaagttgctgaataaagccattaagaagcgaggggactatgat
gctaacattgtcgccgtggtgaatgacacagtagggaccatgatgacctgcggttatgat
gaccaacagtgtgaagtcggcctgatcattggcacaggcaccaatgcttgctacatggag
gaactgcgacacatcgacctggtggaaggcgacgaggggaggatgtgtattaacacggaa
tggggagcctttggggatgatgggtccctggaagacatccgaaccgagtttgacagagag
ttagaccgtggatctctcaaccctgggaagcagctgttcgagaagatggtgagcggcatg
tacatgggggagctggtccggctaatcctggtgaagatggccaaggaaggcctcttattc
gaagggcgcatcactccagagctgctcacgaggggaaagttcaacactagtgacgtgtcc
gccattgaaaaggataaggaaggcattcaaaatgccaaggaaatcttaacccgcttggga
gtggagccgtctgatgttgactgtgtgtcggtccagcacatctgcacgatcgtctccttc
cgatcagccaacctggtggccgccacgctcggtgccatcttgaaccgcctgcgggacaac
aagggcacaccacgcctgcggaccacggttggcgtggacggttctctctacaagatgcac
ccacagtactcccggcggttccacaagaccctgaggcgcctggtgcctgactccgacgtc
cgtttcctcctctcagagagtggcacgggcaagggggccgccatggtgacggcagtagcc
taccgcctggctgagcagcaccggcagattgaggaaaccctggcccacttccgcctcagc
aagcagacgctgatggaggtgaagaagaggctacggacagagatggaaatggggctgagg
aaggagaccaacagcaaagctactgtcaaaatgctgccttcttttgtccggagcatcccg
gatgggactgaacacggtgacttcctggccttggatcttggaggaacgaatttccgggtt
ctgctggtaaagatccgcagtgggaaaaagagaacagtggaaatgcacaacaagatctac
tccattcccctggaaatcatgcagggcaccggggatgagctgtttgaccacatcgtctcc
tgcatctctgacttcctggactacatggggatcaaaggcccccggatgcctctgggcttc
accttctcatttccctgccatcagacgaacctggactgtggaatcttgatctcatggaca
aagggtttcaaagccactgactgtgagggccatgatgtagcctccttactgagggatgcg
gtgaagaggagagaggaatttgacttggatgtggtggctgtggtcaacgacaccgtgggc
accatgatgacctgtgcgtatgaagaacccacttgcgaaattggactcatcgtggggacg
ggcaccaatgcctgctacatggaggagatgaagaatgtggagatggtggaggggaaccag
ggccagatgtgcatcaacatggagtggggcgccttcggtgacaatgggtgtctggatgac
atcagaacagactttgacaaagtggtggacgaatattctctaaactctgggaaacaaagg
tttgagaaaatgatcagtgggatgtacctgggtgagatcgtccgtaacatcctgattgac
ttcaccaagaaaggcttcctcttccggggacagatctccgaaccactcaagacccgaggc
atctttgagaccaagtttctctctcagattgagagtgaccggttagcgctgctccaggtg
cgggccatccttcagcagctgggtttgaacagcacgtgtgacgacagtatcctggtcaag
accgtgtgtggggtggtgtccaagagggcggctcagctgtgtggtgccggcatggccgcc
gtggtggaaaagatcagagagaacagaggcctagaccatctgaatgtaactgtgggagtg
gatgggacgctctacaaacttcatccacacttctccagaatcatgcaccaaactgtgaag
gaactgtcaccaaagtgtaccgtgtccttcctcctgtctgaagacggcagcggcaagggg
gccgcccttatcacagctgtgggcgtgcggctcagaggagacccttcgatcgcctaa

DBGET integrated database retrieval system