KEGG   Rattus norvegicus (rat): 25062Help
Entry
25062             CDS       T01003                                 

Gene name
Gpd2, mtGPDH
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    25062 (Gpd2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     25062 (Gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 FAD_oxidored GIDA Pyr_redox_2 EF-hand_9 EF-hand_8 NAD_binding_8 HI0933_like Pyr_redox Pyr_redox_3 Thi4 EF-hand_10
Motif
Other DBs
NCBI-GeneID: 25062
NCBI-ProteinID: NP_036868
RGD: 2726
Ensembl: ENSRNOG00000033824
UniProt: P35571
LinkDB All DBs
Position
3q21
AA seq 727 aa AA seqDB search
MAFQKVVKGTILMGGGALATVLGLSQFAHYRRKQVSLAYVEAATCFSEPVNREPPSREAQ
LMTLQNTSEFDILVIGGGATGCGCALDAVTRGLKTALVERNDFASGTSSRSTKLIHGGVR
YLQKAITNLDVEQYRMVKEALHERANLLEIAPHLSAPLPIMLPLYKWWQLPYYWVGIKMY
DLVAGSHCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPETGKERVSGARCKDVLTGHEFNVRAKCVINATGPFTDSVRKM
DDNDVVPICQPSAGVHIVMPGYYSPENMGLLDPATSDGRVIFFLPWEKMTIAGTTDSPTD
VTHHPIPSEDDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSANTQSISRNH
VVEVSDSGLITIAGGKWTTYRSMAEDTVNKAVKLHNLNAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAKTYGDKAFDVAKMASVTGKRWPVVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPKIVELMGRELNWSELRKQEELETATRFLY
YEMGYKSRTEQLTDSTEISLLPPDIDRYKKRFHMFDEDEKGFITIVDVQRVLESINVQMD
EDTLHEILCEVDLNKNGQVELHEFLQLMSAVHTGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcaaaaggtagtgaaagggactattcttatgggtggaggagctctggccact
gttttgggactctctcagtttgctcactacagaaggaagcaagtaagcctggcgtatgtg
gaagcagcaacatgcttctcagagcccgtgaacagggagcctccttccagagaagctcag
ctcatgactctgcagaacacatcggaatttgacatcctcgtcattggaggaggagccaca
ggatgtggctgtgcgctagacgccgtcaccagaggactgaaaacagcccttgtagagaga
aatgacttcgcatcagggactagcagcagaagcactaaattgatccatggtggcgtacga
tacctccagaaggctatcacgaacttggatgttgaacagtataggatggtgaaagaggcc
cttcatgaacgtgccaacttactagaaatcgctccccatctatcagctccgctgcctata
atgctgccactttataagtggtggcagttaccttattactgggtgggaatcaagatgtat
gatctggttgcaggaagtcattgcctgaagagcagttatgtcctcagtaaatccagagcc
cttgagcatttccccatgctccagaaggacaagctggtcggagccattgtctactatgat
ggacagcacaatgacgcccggatgaacctcgccatcgccctcaccgctgccaggtacggg
gctgccacggccaattacatggaggtggtgagcttgctcaagaagacagaccccgaaact
gggaaagagcgcgtgagtggtgcccggtgcaaggacgtgctcacagggcatgagtttaac
gtgagagctaaatgcgttatcaatgccaccggccctttcacagactccgtgcgcaaaatg
gatgataacgatgttgttcccatctgccagcccagtgcaggggttcacattgtgatgccc
gggtactacagccccgagaacatgggacttcttgatcctgcaaccagtgatggcagagtt
attttcttcttgccttgggagaagatgacaattgcgggtaccactgattcgccaacggac
gtcacgcaccatcctattccttcggaagacgacattaacttcatcttaaatgaagtgcgg
aactacctgagttgcgacgttgaagtgagaagaggggatgtcctggcagcgtggagtggc
attcgcccgcttgttaccgatcccaagtctgcaaacactcagtccatctctcgaaatcat
gttgtggaagtcagcgacagtggcctcatcacaatagcaggtgggaagtggaccacatat
cgctccatggcagaagatactgtgaacaaagctgtcaagcttcacaacttgaatgcagga
cccagtaggaccgttgggctcttccttcaaggaggcaaagattggagccccacactctac
atcaggcttgtccaggactatgggcttgagagtgaggttgcacaacacctggccaaaacc
tatggtgacaaggctttcgacgtggccaaaatggcaagtgtgactggaaaacggtggcct
gttgttggagtgcgtcttgtgtcagaatttccgtacatcgaagcagaggtgaaatatggg
attaaggagtacgcatgcaccgctgttgacatgatttcacgtcgcacccgcctggccttt
cttaatgttcaggctgcagaggaagccctgcccaagattgttgagttaatgggaagagaa
ttgaactggagtgaattgaggaaacaggaagaacttgaaacagccacgaggtttctgtac
tatgaaatgggctataagtctcgaacagaacaactcacagatagtactgaaatcagcctg
ctgcctccagacatcgatcggtacaagaagagatttcacatgtttgatgaagacgaaaaa
ggcttcattaccattgttgatgttcaacgtgtgctagagagtatcaatgtacaaatggac
gaagacacactacatgaaattctctgtgaagtagacttgaacaagaatggtcaggttgag
ctccatgagtttctgcagctgatgagcgcagttcatacaggaagggtgtctggaagccgg
cttgccatcctcatgaagactgccgaggagaacttggaccgtagagttccaatccccgtg
gatcgtagttgtggaggattgtga

DBGET integrated database retrieval system