KEGG   Rattus norvegicus (rat): 25121Help
Entry
25121             CDS       T01003                                 

Gene name
Pcsk2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    25121 (Pcsk2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    25121 (Pcsk2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     25121 (Pcsk2)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S8: subtilisin family
   25121 (Pcsk2)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Subtilisin family
   25121 (Pcsk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 25121
NCBI-ProteinID: NP_036878
RGD: 3273
Ensembl: ENSRNOG00000005438
UniProt: P28841
LinkDB All DBs
Position
3q41
AA seq 637 aa AA seqDB search
MEGGCGSQWKAAGLLFCVMVFASAERPVFTNHFLVELHKDGEEEARQVAAEHGFGVRKLP
FAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINM
NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNY
NSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRML
DQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKG
SIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKR
NPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSKRNQ
LHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPP
TGKLVLTLQTNACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPR
DDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPYID
QVVRDYQSKLAMSKKQELEEELDEAVERSLQSILRKN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggttgtggatctcagtggaaggcggccgggcttctcttctgtgtcatggtt
tttgcgtctgccgagagaccggtcttcacgaatcattttcttgtggagttgcataaagac
ggagaggaagaggctcgccaagttgcagcagaacacggatttggagtccgaaagctcccc
tttgcagaaggcctgtaccacttttaccacaatggccttgcgaaggccaaaagaagacgc
agcctacatcacaagcggcagctggagagagaccccaggataaagatggccctgcagcaa
gaaggatttgaccgtaaaaagagagggtacagagacatcaatgagattgacatcaatatg
aatgatcctctttttacaaagcaatggtacctgttcaacactgggcaagctgacgggact
cctgggctagacttgaatgtggccgaagcctgggagctgggatacacagggaaaggagtg
accattggaatcatggacgatggaattgactatctccacccagacctggcctacaactat
aactctgatgcaagttatgacttcagcagcaatgacccctatccataccctcgatacaca
gatgactggttcaacagccatggaaccaggtgtgcaggagaagtttccgctgcagccagc
aacaatatctgtggagtcggtgtagcatacaactccaaggtggcaggtatccggatgctg
gaccagccctttatgactgacatcatcgaggcctcctccatcagccacatgcctcaactg
atcgacatctacagtgcaagctggggccccacagacaacgggaagacagttgatgggccc
cgagagctcacgctccaggccatggctgatggtgtgaacaagggccgtgggggcaaaggc
agcatctatgtgtgggcctccggggacggtggcagctacgatgactgcaactgtgacggc
tatgcgtcaagcatgtggaccatctccatcaactcggccatcaacgacggcaggaccgcc
ttgtatgacgagagctgctcttccaccttggcctctacgttcagcaacgggaggaagagg
aatcccgaggccggtgtggctaccacagacttgtatggcaactgtactctgaggcattct
gggacatctgcagctgctcctgaggcagctggcgtgtttgcattggctttggaggctaac
gtggatctgacctggcgagacatgcaacatctgacagtgctcacctccaagcgaaaccag
cttcacgatgaggttcatcagtggcgacggaatggggttggcctggaattcaatcacctc
tttggctacggagtccttgatgcaggtgccatggtgaaaatggctaaagactggaaaact
gtcccagagagattccactgtgtgggaggctcggtgcagaaccctgagaaaataccaccc
accggcaagttggtactgaccctccaaacaaatgcatgtgaggggaaagaaaacttcgtc
cgctacctcgagcatgtccaagctgtcatcacagtcaacgcaaccaggagaggagacctg
aacatcaacatgacctccccgatgggcaccaagtccattttgctaagccggcgtccaaga
gacgacgactccaaggtgggctttgacaagtggcctttcatgaccacccacacctggggg
gaggatgcccgagggacctggaccctggagctggggtttgtgggcagtgcaccacagaag
ggcttgctgaaggaatggaccctcatgctacatggcacccagagtgccccatacatcgat
caggtggtgagggattaccaatcgaagttggccatgtccaagaagcaagagctggaggaa
gagctagatgaagctgtggagagaagtctgcaaagtatcctgagaaagaactag

DBGET integrated database retrieval system