KEGG   Rattus norvegicus (rat): 25311Help
Entry
25311             CDS       T01003                                 

Gene name
Dcc
Definition
(RefSeq) DCC netrin 1 receptor
  KO
K06765  deleted in colorectal carcinoma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno05200  Pathways in cancer
rno05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    25311 (Dcc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25311 (Dcc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    25311 (Dcc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 Ig_4 Interfer-bind Ig_6 EphA2_TM CD34_antigen FAM176 V-set_CD47 DUF4998 Ly49 Cadherin_C_2 TMEM154
Motif
Other DBs
NCBI-GeneID: 25311
NCBI-ProteinID: NP_036973
RGD: 2492
Ensembl: ENSRNOG00000033099
UniProt: Q63155
LinkDB All DBs
Structure
PDB: 

Position
18q12.1
AA seq 1445 aa AA seqDB search
MENSLGCVWVPKLAFVLFGASLLSAHLQVTGFQIKPFTSLHFVSEPSDAVTMRGGNVLLN
CSAESDRGVPVIKWKKDGLILALGMDDRKQQLPNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTAKVMVAGPLRFLSQTESITAFMGDTVLLKCEVIGDPMPTIHWQKNQQDL
NPIPGDSRVVVLPSGALQISRLQPGDSGVYRCSARNPASTRTGNEAEVRILSDPGLHRQL
YFLQRPSNVIAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGTYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECAVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQSSAQLIVPKP
AIPSSSILPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTT
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLHAVSAS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYTLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSGPDV
STPMLPPVGVQAVALTHEAVRVSWADNSVPKNQKTSDVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLSLDTMYYF
RIQARNAKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVITVVTVGVLTVLVVVIVAVICTRRSSAQQRKKRATHSASK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPAGTDPAGRGSPIQSCQDLTPVSHSQSESQMGS
KSASHSGQDTEEAGSSMSTLERSLAARRATRTKLMIPMEAQSNNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRTVSEGPTAQQQPMLPPAQPEHPS
SEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTA
SLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDPASVYEQDDLSEQMASLEGLMKQLNAI
TGSAF
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtcttggatgtgtctgggtacccaagctggcttttgtactcttcggagct
tccttgctcagcgcgcatcttcaagtcacgggtttccaaattaaacctttcacgtcactt
cattttgtgtctgaaccttctgatgctgtcacaatgcggggaggaaacgtcctgctcaac
tgctctgcagagtctgaccgcggagtcccagtcatcaagtggaagaaagatggccttatc
ctggccttgggaatggatgacagaaagcagcaacttcctaatgggtctctgttgatacaa
aacatacttcattccagacaccataaaccggatgaaggactttaccaatgcgaggcatcc
ttaggagactctggctcaattattagtcggacagcaaaagttatggtagcaggaccactg
aggttcctctcccagacagaatctatcacagccttcatgggagatacagtgttacttaag
tgtgaagtcattggggaccccatgccaacaatacactggcagaagaatcaacaagacctc
aacccgatcccaggagactcgcgtgtggtcgtcttgccctccggagcattgcagatcagc
cgacttcaaccaggagacagtggagtctaccgatgctcagctcggaatccagccagcaca
agaacaggaaatgaagccgaagtcaggattttatcagacccaggcctgcataggcagctg
tattttctgcagagaccatccaatgtgatagccattgaagggaaagatgctgtcctggag
tgttgtgtttctggctatcctccaccaagtttcacctggttacggggcgaggaggtcatc
caactcaggtctaaaaagtattcgttgttgggtgggagcaatttgctcatctctaatgtg
acagatgatgacagtgggacctatacgtgcgttgtcacatataagaatgagaatattagt
gcctctgcagagctcacggtcttggttccgccatggtttttaaatcacccttccaacctc
tatgcctatgaaagcatggacattgagtttgaatgtgcagtgtccgggaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtgattcctagtgattactttcagatagtg
ggaggaagcaacttacgaatccttggggtggtgaaatcagatgaaggcttttatcaatgt
gtggctgaaaatgaggctggcaatgcccaaagtagtgcccagctgattgtccccaagcct
gccatcccaagctccagcatcctcccttctgctcccagagatgtggtccctgtcttggtt
tctagtcgctttgtccgtttgagctggcgtccacctgccgaagccaaaggaaacattcaa
acattcacagtctttttctccagagagggtgacaacagggagcgagctttgaatacaacc
cagcctgggtcccttcagcttactgtgggaaacttgaaaccagaagccatgtataccttc
agagttgttgcctacaatgagtggggaccaggggagagctctcaacccatcaaggtggcc
actcagcctgagttgcaagttccagggccagtagaaaacctgcacgctgtatctgcctct
cctacctcaattcttattacatgggaaccccctgcctatgcaaatggtccggttcaaggt
tacagattgttttgcactgaggtgtctacaggaaaagaacagaatatagaggttgatgga
ctatcttataaactggaaggcctgaaaaaattcacggaatatactcttcgattccttgct
tataatcgttatggtccgggagtgtctaccgatgacataacagtcgttacactttcagat
gtgccaagtgctccacctcagaacgtctctctggaagtggttaattcaaggagtatcaaa
gtaagctggctccctcctccatcgggaacacaaaatggatttattactggctataaaatt
cgacacagaaagactacccgcaggggtgagatggaaacactggaacccaataacctctgg
tacctcttcacaggattggagaaggggagtcagtacagtttccaagtgtcagccatgact
gtcaatggcactggaccaccttctaactggtacacagcagaaaccccagagaacgactta
gacgagtctcaagttcctgaccagccaagttctctccatgtgaggccccagacaaactgc
atcatcatgagttggactccacctctcaacccaaacatcgtggtgagaggctatattatc
ggatatggtgttggcagcccttatgccgagacagtgcgtgtagacagtaagcagcggtac
tattccatcgagaggctggagtcgagttctcattatgtaatctccttaaaagctttcaac
aatgctggagaaggtgtccctctctacgaaagtgccactacccgttccataacagacccc
actgaccccgttgattattatcctttgcttgatgatttccccacctcgggcccagatgtc
tccacccccatgctcccaccagtaggtgtgcaggctgtggctcttacccacgaggctgtg
agggtcagctgggcagacaactctgtcccgaagaaccagaagacatccgacgttcggctt
tacacggttcggtggaggaccagcttttccgccagtgccaagtacaagtcagaagacaca
acgtctctcagctacacagcgactggcctcaagccaaataccatgtatgagttctcagtc
atggtgacaaagaacagaaggtcaagcacgtggagcatgactgcacacgccaccacctac
gaagctgccccaacttctgctcccaaggatttgacagtcattactcgtgaggggaagcct
cgtgctgtcattgtgagctggcagcctcccttggaagccaatgggaaaatcaccgcttac
atcttgttttataccttggacaagaatatacccatcgatgactggattatggagactatc
agcggtgaccggcttacccatcagatcatggatctgagcctggacactatgtattacttt
cgaattcaagcacggaacgctaaaggcgtggggcccctctcggatcccatcctcttcagg
actttgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatgga
ggttattggccagttgatactaacttgattgatagaagcactctcaacgaaccacccatt
ggacaaatgcaccccccacatggcagtgtaactcctcaaaagaacagtaacctgcttgtc
ataaccgtggtcaccgtgggcgttctcaccgtgttggttgtggtcattgtagcagtgatt
tgtacccggcgctcttcagcccagcaaaggaagaaacgggccacgcacagtgcgagcaag
aggaagggcagtcagaaggacctccggcctccggatctttggatacatcatgaagaaatg
gaaatgaaaaatatcgagaagccggcaggaaccgaccctgcaggaagaggctcccccatc
cagagttgccaagacctcacaccagtcagccacagccagtcagaaagccagatgggaagc
aaaagtgcctcccattcaggtcaagataccgaggaggcagggagctccatgtctactcta
gaaaggtcccttgcagcacggcgggccacgaggaccaagctcatgattcccatggaggcc
cagtccaataatcctgctgtcgtgagtgccatccctgtaccaaccctagaaagtgcccag
tatccaggaatcctcccgtctcccacatgtggatatccgcatccacagttcactctccgg
ccagtaccattcccaacactgtctgtggaccgaggtttcggagcaggaagaactgtgagt
gaaggaccaacagcacaacaacaacccatgctgcccccagctcagcctgaacatcccagc
agcgaagaagcccccagcagaaccatccctacagcctgtgtgcggccaactcacccactc
cgaagttttgcaaaccctttgctacctccacctatgagtgcaatagaaccaaaagtccct
tacacaccgcttttgtcgcagccaggacccacccttcccaagactcatgttaaaacggcc
tcccttgggctagcaggaaaggcaaggtcccctttgcttcccgtatctgtgccaacagcc
cctgaagtgtctgaagagagtcacaagccaacagaggatccagccagtgtatatgaacag
gatgacttgagcgaacaaatggcgagtttggaagggctaatgaagcaactcaatgccatc
acgggctccgccttttga

DBGET integrated database retrieval system