KEGG   Rattus norvegicus (rat): 25358Help
Entry
25358             CDS       T01003                                 

Gene name
Timp3
Definition
(RefSeq) TIMP metallopeptidase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    25358 (Timp3)
   05205 Proteoglycans in cancer
    25358 (Timp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25358 (Timp3)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I35: timp family
   25358 (Timp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 25358
NCBI-ProteinID: NP_037018
RGD: 3865
Ensembl: ENSRNOG00000004303
UniProt: Q4V8L0
LinkDB All DBs
Position
7q13
AA seq 211 aa AA seqDB search
MTPWLGLVLLLSCWSLGHWGTEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNF
VERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSISNATDP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactccctggcttgggcttgtcctgctcctgagctgctggagccttgggcactgggga
acggaagcgtgcacatgctcgcccagccatccccaggatgccttctgcaactccgacatc
gtgatccgggccaaagtggtgggaaagaagctggtgaaggaagggccctttggcactctg
gtctacactattaagcaaatgaagatgtaccgaggattcagtaagatgccccatgtgcag
tacattcacacagaagcctctgaaagtctctgtggccttaagctagaagtcaacaaatac
cagtacctgctgacagggcgcgtgtatgaaggcaagatgtacacagggctgtgcaacttt
gtggagaggtgggaccacctcacactgtcccagcgcaagggcctcaattaccgctaccac
ctgggttgcaattgcaagatcaagtcctgctactacttgccttgctttgtgacctccaag
aatgaatgtctctggaccgacatgctctccaatttcgggtaccctggctatcagtccaaa
cactacgcctgcatccggcagaagggtggctactgcagctggtaccgaggatgggccccc
ccagacaagagcatcagcaatgccacagacccctga

DBGET integrated database retrieval system