KEGG   Rattus norvegicus (rat): 25387
Entry
25387             CDS       T01003                                 

Gene name
Arrb1, BARRES
Definition
(RefSeq) arrestin, beta 1
  KO
K04439  beta-arrestin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04340  Hedgehog signaling pathway
rno04728  Dopaminergic synapse
rno04740  Olfactory transduction
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25387 (Arrb1)
   04340 Hedgehog signaling pathway
    25387 (Arrb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25387 (Arrb1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    25387 (Arrb1)
  09152 Endocrine system
   04929 GnRH secretion
    25387 (Arrb1)
   04926 Relaxin signaling pathway
    25387 (Arrb1)
   04928 Parathyroid hormone synthesis, secretion and action
    25387 (Arrb1)
  09156 Nervous system
   04728 Dopaminergic synapse
    25387 (Arrb1)
  09157 Sensory system
   04740 Olfactory transduction
    25387 (Arrb1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25387 (Arrb1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    25387 (Arrb1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C LDB19
Other DBs
NCBI-GeneID: 25387
NCBI-ProteinID: NP_037042
RGD: 2156
Ensembl: ENSRNOG00000030404
UniProt: P29066
LinkDB
Structure
PDB: 
4JQI

Position
1q32
AA seq 418 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggcgacaaagggacacgagtgttcaagaaggcaagccccaatggaaagctcaccgtc
tacctgggaaagcgggactttgtggaccacattgacctggtggaccccgtggatggcgtg
gtcctggtggatcctgagtatctcaaagaaaggcgagtctacgtgacactgacctgcgcc
ttccggtatggccgggaagacctggatgtcttgggtctgacttttcgcaaagacctgttt
gtggctaacgtgcagtccttcccaccggcccctgaggacaagaagccactgactcggcta
caagagcgactcatcaagaagctgggcgagcatgcctaccccttcacctttgagatcccg
ccaaaccttccgtgctcagtcacattgcaacctgggcctgaggacacagggaaggcctgc
ggtgtggattatgaagtgaaagccttctgtgctgagaacctggaggagaagatccacaaa
aggaattctgtgcggctagtcatccggaaggttcaatatgcccctgagaggcctggccct
cagcccacggctgagaccaccagacagttcctcatgtcggacaagcccctgcaccttgag
gcatctctggataaggagatctattatcatggagaacccatcagcgtcaatgtccatgtc
accaacaacaccaacaagactgtgaagaagatcaagatctcggtgcgccagtatgcagac
atctgtctcttcaacacagctcagtacaagtgcccagtggccatggaggaagctgatgat
actgtggcacccagctcaacattctgcaaggtctacacactgactcccttcctggcaaac
aacagagagaagcgggggcttgccctcgacgggaagctcaagcatgaagacacaaatctg
gcttccagcactctgttgcgggaaggcgccaaccgtgaaatcctgggtatcattgtttcc
tacaaagtcaaagtgaagctggtggtgtcccggggcggcctgttgggagaccttgcatcc
agtgatgtggctgtggaactgccctttaccttaatgcaccccaagcctaaagaggagccc
ccacatcgggaagttccagagagcgagactccagtagacaccaatctcatagagcttgac
accaatgatgacgacattgtgtttgaggactttgctcgtcagcggctgaaaggcatgaag
gatgacaaggacgaagaggatgatggcaccggctctccacacctcaacaacagatag

KEGG   Rattus norvegicus (rat): 25388
Entry
25388             CDS       T01003                                 

Gene name
Arrb2, BARRES
Definition
(RefSeq) arrestin, beta 2
  KO
K04439  beta-arrestin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04340  Hedgehog signaling pathway
rno04728  Dopaminergic synapse
rno04740  Olfactory transduction
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25388 (Arrb2)
   04340 Hedgehog signaling pathway
    25388 (Arrb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25388 (Arrb2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    25388 (Arrb2)
  09152 Endocrine system
   04929 GnRH secretion
    25388 (Arrb2)
   04926 Relaxin signaling pathway
    25388 (Arrb2)
   04928 Parathyroid hormone synthesis, secretion and action
    25388 (Arrb2)
  09156 Nervous system
   04728 Dopaminergic synapse
    25388 (Arrb2)
  09157 Sensory system
   04740 Olfactory transduction
    25388 (Arrb2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25388 (Arrb2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    25388 (Arrb2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 25388
NCBI-ProteinID: NP_037043
RGD: 2157
Ensembl: ENSRNOG00000019308
UniProt: P29067
LinkDB
Position
10q24
AA seq 410 aa
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPG
PQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQY
ADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDT
NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQ
SAPREIDIPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDCDDQFC
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgggtgaaaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgtgactttgtggatcacttggacaaagtggatcctgtcgatggt
gtggtgcttgtggatcctgactacttgaaggaccggaaagtgtttgtgaccctcacctgt
gccttccgctatggccgagaagacctggatgtactgggcctgtctttccgcaaagatctg
ttcatcgccacctaccaggccttcccccccatgcccaacccacctcggccccccacccgc
ctacaggaccgactgctgaagaagttgggccagcatgcccaccccttttttttcacaata
ccccagaatttgccttgctccgtcacactgcagccaggaccggaggacacagggaaggcc
tgtggagtagactttgagattcgagccttctgtgccaaatctatagaagaaaaaagccac
aaaaggaactccgtgcggcttatcatcagaaaggtacagtttgctcctgagacacccggc
ccccagccatcagctgaaaccacacgccacttcctcatgtctgaccggaggtccctgcac
ctagaggcttccctggacaaagagctgtactaccatggggaacccctcaatgtcaacgtc
cacgtcaccaacaattctgccaagaccgtcaagaagatcagagtgtctgtgagacagtat
gccgacatttgcctcttcagcaccgcgcagtacaagtgtcctgtggctcagcttgaacaa
gatgaccaggtgtctcccagttccacattctgcaaggtgtacaccataaccccgctgctc
agtgacaaccgagagaagcgtggccttgcccttgatgggcaactcaagcacgaagacacc
aacctggcttccagcaccattgtgaaggagggagccaacaaggaggtgctgggaatccta
gtatcctacagggtcaaggtgaagctggtggtgtctcgaggcggggatgtctccgtggag
ctacctttcgtcctaatgcaccccaagccccacgaccacatcacccttccccgaccccag
tcagccccccgggaaatagacatccctgtggataccaacctcattgaattcgataccaac
tatgccacagacgacgacatcgtgtttgaggactttgcgaggcttcggctgaaggggatg
aaggatgacgactgtgatgaccagttctgctag

DBGET integrated database retrieval system