KEGG   Rattus norvegicus (rat): 25496
Entry
25496             CDS       T01003                                 

Gene name
Notch1, NOTCH, TAN1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno05020  Prion disease
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    25496 (Notch1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    25496 (Notch1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    25496 (Notch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25496 (Notch1)
   05206 MicroRNAs in cancer
    25496 (Notch1)
  09162 Cancer: specific types
   05224 Breast cancer
    25496 (Notch1)
  09164 Neurodegenerative disease
   05020 Prion disease
    25496 (Notch1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25496 (Notch1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25496 (Notch1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 Notch NOD Ank DUF3454 NODP Ank_5 Ank_4 Ank_3 EGF_3 cEGF
Other DBs
NCBI-GeneID: 25496
NCBI-ProteinID: NP_001099191
RGD: 3187
Ensembl: ENSRNOG00000019322
UniProt: Q07008
LinkDB
Structure
PDB: 
4XL1 5UK5 4XLW

Position
3p13
AA seq 2531 aa
MPRLLAPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDP
SPCLSTPCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLANACLANPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNSHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGLCKDGVATFTCLCQPGYTGHHC
ETNINECHSQPCRHGGTCQDRDNYYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKID
GYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNEC
NSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKN
SGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGSYRCLCQAGYT
GRNCESDIDDCRPNPCHNGGSCTDGVNAAFCDCLPGFQGAFCEEDINECASNPCQNGANC
TDCVDSYTCTCPTGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQY
DVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQ
YHCECRSGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQAGYTGS
YCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCID
LTNTYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFV
GERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCRNGG
VCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG
PECQFPASSPCVGSNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFTGGAGRDI
PPPQIEEACELPECQEDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYY
GREEELRKHPIKRSAVGWATTSLLPGTNGGRQRRELDPMDIHGSIVYLEIDNRQCVQSSS
QCFQSATDVAAFLGALASLGSLNIPYKIEAVKSETVEPPLPSQLHLMYVAAAAFVLLFFV
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQ
NEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRVSAMAPTPPQGEVDAD
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGET
ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNRATDLDA
RMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKN
GANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACSS
KEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMP
LSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNG
TGAMNFTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHGMMGPI
HSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQIQPQNLQPPSQPHLSVSSAA
NGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPP
SQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTSMP
SQITHIPEAFK
NT seq 7596 nt   +upstreamnt  +downstreamnt
atgccgcggctcctggcgcccttgctctgcctaacgctgctgcccgcgctcgccgcaaga
ggcttgagatgctcccagccaagtgggacctgcctgaatggagggaggtgcgaagtggcc
aacggcactgaagcctgtgtctgcagcggagcgttcgtgggccagcgatgccaggacccc
agcccttgcctcagcacaccatgtaagaatgctggaacgtgctatgttgtggaccatggc
ggcatcgtggactatgcctgcagttgccccctgggtttctctgggcccctctgcctgaca
cctctggccaatgcctgcctggccaacccctgccgcaacggggggacctgtgacctgctc
actctcacagaatacaagtgccggtgcccgccagggtggtcaggaaagtcatgtcagcaa
gccgacccctgtgcctccaacccctgtgccaatggtggccagtgcctgccctttgagtct
tcatacatctgtggctgcccgcccggcttccatggccccacctgcagacaagatgttaac
gagtgcagccagaaccctgggttgtgccgtcatggcggcacgtgccacaatgagattggc
tcctatcgctgtgcctgccgtgccacccacactggtccccactgcgagctgccctacgtg
ccctgcagcccctcaccctgccagaacggaggcacctgccgccctacgggggacaccacc
cacgagtgtgcctgcctgccaggctttgctggacagaactgtgaagaaaatgtggatgac
tgcccaggaaacaactgcaagaacgggggtgcctgtgtggacggtgtgaatacctacaat
tgccgctgcccaccggagtggacaggtcagtactgcacagaggatgtggacgagtgtcag
ctcatgcccaacgcctgccagaatggcggaacctgccacaactcccacggtggctacaac
tgcgtgtgtgtcaatggctggactggtgaggactgcagtgagaacattgatgactgtgcc
agtgccgcctgttttcagggtgccacctgccatgaccgtgtggcttccttctactgcgag
tgtccacatgggcgcacaggcctgctgtgccacctgaacgatgcgtgtatcagcaacccc
tgcaacgagggctccaactgcgacaccaaccctgtcaacggcaaggccatctgcacttgc
ccctcggggtacacggggccagcctgcagccaggacgtggatgagtgcgctctaggtgcc
aacccgtgtgagcacgcgggcaagtgcctcaacacactgggctctttcgagtgtcagtgt
ctacagggctacactgggccccgctgtgagattgatgtcaacgagtgcatctccaaccca
tgtcagaatgatgccacgtgcctggaccagattggggagtttcagtgtatatgtatgcca
ggttatgagggtgtatactgtgagatcaacacggacgagtgtgccagcagcccctgtcta
cacaatggccgctgcgtggacaagatcaacgagttcctgtgtcagtgtcccaaaggcttc
agcgggcacctgtgccagtatgacgtggatgagtgcgccagcacaccatgcaagaacggc
gccaagtgcctggatgggcccaacacctacacctgcgtgtgcacagaaggttacacgggg
acccactgcgaggtggacattgacgagtgtgaccctgacccctgtcactatggtttgtgc
aaggatggtgtggccacctttacctgcctctgccagccaggctacacaggccatcactgt
gagaccaacattaatgagtgtcacagccagccgtgccgccatggcggcacctgccaggac
cgtgacaactactacctctgcttatgcctcaaggggaccacaggacccaactgtgagatc
aatctggatgactgtgcgagcaacccctgtgactctggcacgtgtctggacaagatcgat
ggctacgagtgtgcgtgcgagccaggctacacagggagcatgtgtaatgtcaacattgac
gaatgtgcgggcagcccctgccacaacgggggcacctgtgaggatggcatcgccggcttc
acttgccgctgccccgagggctaccacgaccctacgtgcctgtctgaggtcaacgagtgc
aacagtaacccctgcatccatggagcttgccgggatggcctcaatggatacaaatgtgac
tgtgcccctgggtggagtgggacaaactgtgacatcaacaacaatgagtgtgagtccaac
ccttgtgtcaacggtggcacctgcaaagacatgaccagtggctacgtatgcacctgccga
gaaggcttcagtggccctaactgccagaccaacattaacgaatgtgcttccaacccctgc
ctgaaccagggcacctgcattgatgatgtcgctgggtacaaatgcaactgccctctgccc
tatacaggagccacatgtgaggtggtgttggccccatgtgccaccagcccctgcaaaaac
agtggggtatgcaaggagtctgaggactatgagagcttttcctgtgtctgtcccacaggc
tggcaaggtcaaacctgcgagatcgacatcaatgagtgtgtgaaaagcccgtgtcgccat
ggtgcctcttgccagaacaccaatggcagctaccgctgcctctgccaggctggctacacg
ggtcgcaactgcgagagtgacatcgatgactgccgacccaacccatgtcacaacgggggt
tcctgcactgacggggtcaacgcggccttctgcgactgcctgcccggcttccagggtgcc
ttctgtgaggaggacatcaacgaatgcgccagcaatccatgccaaaatggcgccaactgc
actgactgcgtggacagctacacgtgcacctgccccacgggcttcaatggcatccattgc
gagaacaacacacctgactgtaccgagagctcctgtttcaatggtggcacctgtgtggat
ggtatcaactccttcacctgtctgtgcccacctggcttcacgggcagctactgccagtat
gacgtcaatgagtgtgactcacggccctgtctgcatggtggcacctgccaagacagctat
ggtacctataagtgtacctgcccacagggctacactggtctcaactgccagaaccttgtg
cgctggtgtgactcagctccctgcaagaatggcggcaagtgctggcagaccaacacacag
taccactgcgagtgccgcagcggctggactggcttcaactgcgacgtgctcagtgtgtcc
tgcgaggtggctgcacagaagcgaggcatcgatgtcactctcctatgccagcacggaggg
ctctgtgtggatgaggaagacaagcattactgccactgccaggcaggatacacgggcagc
tactgtgaggacgaggtggacgagtgctcacctaatccctgccagaacggagccacctgc
actgactatctcggtggcttttcctgcaagtgtgtggctgggtaccatggctctaactgc
tctgaggagatcaacgagtgcctatcccaaccctgccagaatgggggtacctgcattgat
ctgaccaacacctacaagtgctcctgccccaggggcacacagggtgtacactgtgagatc
aacgtcgatgactgccatcctcccctagaccctgcttcccgaagccccaaatgcttcaat
aatggcacctgcgtggaccaggtgggtggctatacctgcacctgcccgccaggcttcgtc
ggggagcggtgcgagggcgatgtcaatgagtgtctctccaacccctgtgacccacgtggc
acccagaactgcgtgcagcgtgttaatgacttccactgcgagtgccgggctggccacact
ggacgccgctgtgagtcggtcattaatggctgcaggggcaaaccatgcaggaatggaggt
gtctgtgctgtggcctccaacaccgcccgtggattcatctgtaggtgccctgcgggcttc
gagggtgccacttgtgaaaatgacgcccgcacttgtggcagtttgcgctgcctcaacggt
ggtacgtgcatctcaggcccacgcagtcccacctgcctatgcctgggctccttcactggc
cctgaatgccagttcccagccagcagcccctgtgtgggtagcaacccctgctacaatcag
ggcacctgtgagcccacatccgagagccctttctaccgctgtctatgccctgccaaattc
aacgggctgctgtgccacatcctggactacagcttcacaggtggcgccgggcgcgacatt
cccccgccacagattgaggaggcctgcgaactgcctgagtgccaggaggatgcaggcaat
aaggtctgcaaccttcagtgtaataatcacgcgtgtggctgggacggcggcgactgctcc
ctcaacttcaatgacccttggaagaactgcactcagtccctgcagtgctggaagtatttt
agtgacggccactgtgacagccagtgcaactcagctggctgcctttttgatggcttcgac
tgccagctcaccgagggacagtgcaaccccctgtatgaccagtactgcaaggaccacttc
agtgatggccactgcgaccagggctgcaacagtgccgagtgtgagtgggatggactggac
tgtgcagagcatgtccccgagcgactggcagccggcacactggtgctggtggtgctgctt
ccgcccgatcagctacgcaacaactccttccacttcctgcgggagctcagccacgtgctg
cacaccaacgtggtcttcaagcgtgacgcgcagggccagcagatgatcttcccctactat
ggccgcgaggaagagctacgcaagcacccgatcaagcgttctgcagtgggctgggccaca
acgtcactgcttcctggcaccaatggtgggcgccagcgcagggagctggaccccatggac
atccatggctccatcgtctacctggagatcgacaaccggcagtgtgtacagtcatcctcg
caatgcttccagagcgccaccgatgtggctgccttcctaggtgctcttgcctccctcggc
agcctcaatatcccctacaagatcgaagccgtaaagagtgagacggtggagcctccgctg
ccctcacagctgcacctcatgtacgtggcggcagctgccttcgtgctcctgttctttgtg
ggctgtggggtgctgctgtcccgcaagcgcaggcggcagcatggccagctctggttccct
gagggtttcaaagtgtcagaggccagcaagaagaagcggagagaacccctcggcgaggac
tcagtcggcctcaagcccctgaagaacgcctcagatggtgccctgatggacgacaatcag
aacgagtggggggacgaagacctggagaccaagaagttccggtttgaggaaccagtggtt
ctccctgacctggatgatcagactgaccaccggcagtggacccagcagcacctggatgcc
gctgacctacgtgtgtctgccatggccccaacgccgcctcagggggaggtagatgctgac
tgcatggacgtcaatgttcgaggaccagatggcttcactcccctaatgattgcctcctgc
agcggagggggcctggagacaggcaacagtgaggaagaagaagatgcacctgctgtcatc
tccgacttcatctatcagggtgccagcttgcacaaccagacggaccgcacaggggagact
gccctgcacctggctgcccgatactctcgttcagatgctgccaagcgcttgctggaggcc
agcgcagatgccaacatccaagacaacatggggcgtaccccattacatgccgctgtttct
gcagacgctcagggtgtcttccagatcctgctccggaacagagccacagatctggatgcc
cgaatgcatgatggcacaacccctctgatcctggcggcacgcctggccgtggaaggcatg
ctagaggacctcatcaactctcacgctgatgtcaatgctgtggatgacctaggcaagtca
gctctgcactgggcagccgctgtgaacaatgtggacgctgctgttgtgctcctgaagaac
ggagccaacaaagacatgcagaacaacaaggaggagactcccctgttcctggccgcccgt
gagggcagctatgagactgccaaagtgttgctggaccactttgccaaccgggacatcacg
gatcacatggaccgattgccacgggacattgcacaggagcgcatgcaccacgatatcgtg
cggcttttggatgaatacaacctggtgcgcagcccacagctgcatggcactgccttgggt
ggcacacccactctgtctcccacactctgctcgcccaacggctacctgggcaacctcaag
tctgccacacagggcaagaaggcccgaaagcccagcaccaaagggctggcttgcagtagc
aaggaagctaaggacctcaaggcccggaggaagaagtcccaggatggcaagggctgcctg
ttggacagctcaagcatgctgtcacccgtggactccctcgagtcaccccatggctacttg
tcagatgtggcctcaccacccctccttccctccccgttccagcagtctccatccatgcct
ctcagccacctgccaggtatgcctgacacccacctgggcatcagccacttgaatgtggca
gccaagcccgagatggcagctctggccggaggcagccggttggcctttgagccaccccca
ccacgcctctcccacctgcctgtagcctccagtgccagcacagtgctgagtaccaatggc
acaggggctatgaatttcaccgtgggtgcaccggcaagcttgaatggccagtgtgagtgg
cttccccggctccagaatggcatggtgcccagccagtacaacccgctaaggccaggtgtg
actccgggcacactaagcacacaggcagctggcctccagcatggcatgatgggcccgata
cacagcagcctctccaccaataccttgtccccgattatctaccagggcctgcccaacaca
aggctggccacacagccccacctggtgcagacccagcaggtgcagccacagaacttacaa
atccagcctcagaacctgcagccaccatcgcagccacacctcagtgtgagctcagcagcc
aatgggcacctgggtcggagcttcctgagcggggagcccagccaggcagacgtacagccg
ctgggccccagcagtctgcctgtgcacaccattctgccccaggaaagccaggctctgccg
acatcactgccatcctccatggtcccacccatgaccactacccagttcctgacccctcct
tctcagcacagctactcatcctcacctgtggacaacacccccagccaccagctgcaggtg
ccagagcaccccttcctcaccccatcccctgagtcccctgaccagtggtccagctcctcc
ccgcattccaacatctctgattggtccgagggcatctctagcccgcccacgagcatgccg
tcccagatcacccacattccagaggcatttaagtaa

KEGG   Rattus norvegicus (rat): 29492
Entry
29492             CDS       T01003                                 

Gene name
Notch2
Definition
(RefSeq) notch 2
  KO
K20994  Notch 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    29492 (Notch2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    29492 (Notch2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    29492 (Notch2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29492 (Notch2)
   05206 MicroRNAs in cancer
    29492 (Notch2)
  09162 Cancer: specific types
   05224 Breast cancer
    29492 (Notch2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    29492 (Notch2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    29492 (Notch2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 EGF_2 Notch Ank_2 NOD Ank Ank_5 NODP Ank_3 Ank_4 cEGF
Other DBs
NCBI-GeneID: 29492
NCBI-ProteinID: NP_077334
RGD: 3188
Ensembl: ENSRNOG00000018835
UniProt: G3V8G9
LinkDB
Position
2q34
AA seq 2471 aa
MPALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGTCVTYHNGTGYCRCPEGFLGE
YCQHRDPCEKNRCQNGGTCVTQAMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGT
CHMLSWDTYECTCQVGFTGKQCQWTDVCLSHPCENGSTCSSVANQFSCRCPAGITGQKCD
ADINECDIPGRCQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTSECHCLPGFEGSNCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGTLCDENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCLHGACV
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCMCPEGPHHPSCYSQ
VNECLSSPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCNNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCLDDVSGYTCHCMLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESFTCLCAPGWQGQRCTVDVDECVSKPCMNNGICHNTQGSYMCECP
PGFSGMDCEEDINDCLANPCQNGGSCVDKVNTFSCLCLPGFVGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHDINECSSNPCLNSGTCVDGLGTYRCTCPLGYTGKNCQTLVNLCSPSPCKNKGTCAQ
EKARPRCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLKNNYQCVCRSAFTGRHCETFLDVCPQKPCLNGGTCA
VASNVPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPHCFCLNRKDCESGCAS
NPCQHGGTCYPQRQPPYYSCRCSPPFWGSHCESYTAPTSTPPATCLSQYCADKARDGICD
EACNSHACQWDGGDCSLTMEDPWANCTSSLRCWEYINNQCDELCNTAECLFDNFECQRNS
KTCKYDKYCADHFKDNHCDKGCNNEECGWDGLDCAADQPENLAEGILVIVVLLPPEQLLQ
DSRSFLRALGTLLHTNLRIKQDSQGALMVYPYYGEKSAAMKKQKVARRSLPDEQEQEIIG
SKVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESEDPRNTPLLY
LLAVAVVIILFLILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSTTSEHWGDDEGPQPKKAKAEDDEALLSEDDPVDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVLCGPNRSFLSLKHTPMG
KKARRPNTKSTMPTSLPNLAKEAKDVKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHTY
VSDATSSPMITSPGILQASPTPLLAAAPAAPVHAQHALSFSNLHEMQPLAPGASTVLPSV
SQLLSHHHIVPPGSGSAGSLGRLHSVPVPSDWMNRVEMSETQYSEMFGMVLAPAEGTHPG
MAAPQSRAPEGKPIPTQREPLPPIVTFQLIPKGSLAQAAGAPQTQSGCPPAVAGPLPSMY
QIPEMARLPSVAFPPTMMPQQEGQVAQTIVPTYHPFPASVGKYPTPPSQHSYASSNAAER
TPNHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGPGTHMS
EPPHSNMQVYA
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgcccgctctgcgtcccgccgcgctgcgggcgctgctgtggctctggctgtgcggcgcg
ggccccgcgcacgctttgcagtgtcgaggtggtcaagagccctgtgtaaatgaggggacc
tgtgttacctaccacaacggcacaggctactgccgatgtccagagggcttcttgggagaa
tattgtcaacatcgagacccttgtgagaagaaccgctgtcagaatggtggtacttgtgtg
acgcaggccatgttgggaaaagccacctgtcgatgtgctccagggttcacaggggaggac
tgccaatactcgacctctcacccctgttttgtttcccgcccctgtcagaatggaggtacc
tgccacatgctcagctgggacacctatgagtgcacctgtcaagttggcttcacaggaaag
cagtgtcagtggacagatgtctgtctgtctcatccctgtgaaaatggaagcacctgtagc
tctgtggccaaccagttctcctgcagatgtcctgcaggcatcacaggccagaagtgtgac
gccgacatcaatgaatgtgacattccaggacgctgccaacatggaggcacctgcctcaac
cttcctgggtcctaccgatgccaatgccctcagggcttcacaggccagcactgtgacagc
ccgtacgtgccctgtgcaccctcaccctgcgtcaatggaggcacctgccgtcagactgga
gacttcacttctgaatgccattgcctgccaggctttgaagggagcaactgcgagcggaat
atcgacgactgccctaaccacaagtgtcagaatggaggggtgtgtgtggatggcgtcaat
acttacaactgccgctgcccccctcagtggactgggcagttctgcacagaagacgtggat
gagtgtctgctgcagcccaatgcttgtcagaatggaggcacttgcaccaaccgcaacgga
ggctacggctgcgtgtgcgtgaacggctggagtggggatgactgcagcgagaacatcgat
gactgtgccttcgcttcctgcacgccaggctccacctgtattgaccgtgtggcctccttc
tcctgcctttgtccagagggaaaggcagggctcctgtgtcatctggatgatgcctgtatc
agcaacccttgtcacaagggggcgctgtgtgataccaaccccctgaatgggcagtacatt
tgcacctgcccacagggctacaagggcgctgactgcacagaagacgtggatgagtgtgct
atggccaacagtaacccttgtgagcatgcaggaaagtgtgtgaatacagatggcgccttc
cactgcgagtgtctgaagggctacgcagggcctcgctgtgagatggacatcaacgagtgt
cactcagacccctgtcagaacgacgccacctgcctggataagattggaggcttcacctgt
ctctgcatgccgggtttcaaaggtgtgcattgtgaactggaggtgaatgaatgccagagc
aacccgtgtgtaaacaatgggcagtgtgtggacaaagtcaatcgcttccagtgtctgtgt
ccccctggtttcacaggaccagtgtgccagatcgacattgacgactgctccagtactccc
tgcctgaatggggccaagtgcatcgatcacccgaatggctatgaatgccagtgtgccaca
ggattcactggcacactgtgtgatgagaacatcgacaactgtgacccggatccttgccac
catggccagtgccaggatgggattgactcctacacctgcatctgcaaccccgggtacatg
ggagccatctgtagtgaccagattgatgaatgctacagcagcccctgcctgaatgatgga
cgctgcatcgacctggtgaacggctaccagtgcaactgccaaccgggtacctcaggcctt
aattgtgaaattaattttgatgactgtgccagcaacccttgtctgcacggagcctgtgtg
gacggcatcaaccgttacagttgtgtgtgctctccgggattcacagggcagaggtgcaac
atagacattgatgagtgtgcctccaacccctgtcgcaagggtgcgacgtgcatcaatgac
gtgaatggtttccggtgtatgtgccctgagggaccacaccatcccagctgctactcacag
gtgaacgagtgtttgagcagtccctgcatccatggaaactgtactggaggtctcagtggc
tataagtgcctctgcgatgcaggctgggttggtatcaactgcgaagtggacaaaaatgag
tgtctttctaacccgtgccagaatggagggacatgtaataacctggtgaatggctacagg
tgtacatgcaagaaggggttcaaaggctataactgccaggtgaacatagatgagtgtgcc
tcgaacccgtgtctgaaccaagggacctgcctcgatgacgtcagtggctacacctgccac
tgcatgctgccttacacaggcaagaattgtcaaacggtgttggcgccctgctcccctaac
ccgtgtgagaacgctgcagtttgtaaagaggcacccaactttgagagcttcacctgcctg
tgtgcccctggctggcaaggtcagcgctgtacagttgacgttgatgagtgtgtctccaag
ccgtgtatgaacaatggcatctgccataatactcagggcagctacatgtgcgagtgccct
cccggcttcagtggtatggactgtgaggaggacatcaatgactgccttgccaacccctgc
cagaacggaggctcctgtgtggacaaagtgaacaccttctcctgcctgtgccttcctggc
ttcgtaggggacaagtgccaaacagacatgaatgaatgtctgagcgagccctgtaagaat
ggggggacctgctctgactacgtcaacagctacacctgcacgtgccctgcgggcttccat
ggagtccactgtgaaaacaacatcgatgagtgcactgagagctcctgtttcaatggcggc
acgtgtgttgatgggatcaactctttctcttgcttatgccctgtgggtttcactggtccc
ttctgcctccatgatatcaatgagtgcagctctaacccgtgcctgaattcgggaacgtgt
gttgatggcctgggtacctaccgatgcacctgtcccttgggctacactgggaaaaactgt
cagaccctggtgaacctctgcagcccctctccatgtaaaaacaaaggaacttgtgctcag
gaaaaggcaaggccacgctgcctgtgtccgcctggatgggatggcgcatactgtgatgtg
ctcaatgtgtcctgtaaggcggcagccttgcagaaaggagtacctgttgaacacttgtgc
cagcactcgggtatctgtatcaatgctggcaacacgcatcactgccagtgccccctgggc
tacacggggagctactgcgaggaacagcttgacgagtgtgcgtccaatccatgccagcat
ggtgccacctgcagtgacttcatcggaggatacagatgtgagtgtgttccagggtatcag
ggtgtcaactgtgagtatgaagtggacgagtgccagaaccagccctgtcagaacggaggc
acctgcatcgacctcgtgaaccatttcaagtgctcgtgcccaccaggcacccggggcctg
ctttgtgaagagaacattgatgactgtgctgggggcccccactgccttaatggtggccag
tgtgtggaccggattggaggctacagttgtcgctgtttgcctggctttgctggggagcgg
tgtgagggggacatcaatgaatgcctgtccaatccttgcagctcagagggcagcctggac
tgcattcagctcaaaaataactaccagtgtgtctgccgcagcgccttcacaggccgacac
tgcgaaaccttcctagatgtgtgtccccagaagccttgcctgaatggagggacttgtgct
gtggctagcaacgtgcctgatggcttcatttgtcgttgtcccccagggttctccggggca
agatgccagagcagctgtggacaagtgaagtgcagaagaggggagcagtgtgtgcacacc
gcctcgggaccccactgcttctgcctgaaccgcaaggactgcgagtcaggttgcgctagt
aacccctgccagcacggaggcacctgctaccctcagcgccagcctccttactactcttgc
cgctgctccccaccgttctggggcagccactgcgagagctacacagcccccaccagcacc
cctcctgctacctgtctgagtcagtactgtgccgacaaggctcgggacggcatctgtgat
gaggcctgcaacagtcatgcctgccagtgggatggaggtgactgttccctcactatggag
gacccctgggccaactgcacctcctcacttcgctgctgggagtacatcaacaaccagtgt
gatgagctgtgcaacactgcagagtgcctgtttgacaactttgaatgccagaggaatagc
aaaacctgcaagtatgacaaatactgtgcagaccacttcaaagacaatcactgcgataag
ggatgcaacaacgaggagtgtggctgggacgggctggactgcgctgcggaccagcctgag
aacctggcggagggcatcctggtcatcgtggtgctcctaccccctgagcagctgcttcag
gattctcgaagcttcttgagggccctgggcaccctgctccacaccaacttacgcattaaa
caagactctcagggcgccctcatggtgtacccctactatggggagaagtcagctgccatg
aagaagcagaaggtggcacgcaggtctcttcctgatgagcaggaacaggagataataggc
tctaaggtatttctggaaatcgacaaccgacagtgtgttcaagactcagaccagtgcttc
aagaacacagatgctgcagctgctctcctggcttctcatgccatccaagggaccttgtcc
taccctctggtgtctgttgtcagtgaatcggaggatccaaggaacactccgctcctctat
ctgcttgcggttgctgtggtcattatcctgttcctcatcctgctgggggtcatcatggca
aagcggaagcgcaagcacggcttcctctggctgcctgaaggcttcacgcttcgccgagac
tccagcaatcacaagcgccgtgaacctgtggggcaggatgccgtggggctgaagaatctc
tcagtgcaagtgtcagaggcaaacctgatcggctccacgacaagcgagcattggggtgat
gatgaaggaccccagccaaagaaagccaaggctgaggacgacgaggctttgctgtcggaa
gacgaccctgtcgaccggcgcccctggacacagcagcaccttgaagctgcagacatccgc
cggactccatccctggcgctcacccctcctcaggcagagcaggaggtggacgtgctggac
gtgaatgtccgaggcccagatgggtgcaccccactgatgctggcttctctccgaggaggc
agctcagacctgagtgatgaagatgaagatgctgaggactcttctgccaacatcatcaca
gacttggtctaccaaggtgccagcctccaggcacagacggaccgcactggtgagatggcc
ctgcaccttgcagcccgctattcgagagctgatgctgccaaacgcctcctggatgctggt
gcagatgccaacgcccaggacaacatgggccgctgtcctcttcatgctgcagttgcagcg
gatgcccaaggtgtcttccagattctgatccgcaaccgagtaacggatctagacgccagg
atgaatgatggcactacccccctgatcctggctgcccgcctggctgtggaaggaatggtg
gcagagctgatcaactgccaagcagatgtgaacgcagtggatgaccatggaaaatctgcc
ctccactgggcagccgccgtcaataatgtggaggcaactcttttgctgttgaagaatggg
gccaaccgggatatgcaggacaacaaggaagagacacctttgtttcttgctgcccgagag
ggaagttatgaagcagccaaaatcctgttagaccactttgccaaccgggacatcacggac
cacatggaccgccttccccgggatgtggctcgggaccgcatgcaccatgacatagttcgc
ctcctggacgagtacaacgtgactcccagccctccggggactgtcttgacttctgctctc
tcacctgtcctctgtgggcccaacaggtctttcctcagtctgaagcacaccccaatgggt
aagaaggccagacggcccaacaccaagagcaccatgcccacaagcctgcctaaccttgcc
aaggaggccaaggacgtcaaggggagcaggaggaagaagtgtctcaacgagaaggtccag
ctctccgagagctcagtgactttatcccctgtcgactcgctcgagtctcctcacacatat
gtttctgatgccacgtcttcccccatgatcacgtcccctgggatcttacaggcctcaccc
acgcctcttctggctgctgccccagctgccccagtgcatgctcagcatgcactgtctttc
tctaaccttcacgaaatgcagcctttggctcctggagccagcaccgtgctcccctcagtt
agccagttgttgtcccaccaccacatcgtccccccagggagtggcagtgcaggaagcttg
ggcaggttacattcagtccctgtcccctcagactggatgaaccgcgtggagatgagtgag
acccagtacagtgaaatgtttggcatggtcctggctcctgcagagggaacccaccctggc
atggcagctcctcagagcagagctccggaagggaagcccatccccacacagcgtgagccc
ttgcctcccattgtaactttccagctcatcccgaaaggcagccttgctcaagcagctggg
gctccccagacacagtccggctgccccccagctgtggcaggccccttgccctctatgtac
cagatcccagagatggcccgtttgcccagtgtggctttcccacctaccatgatgccccag
caggaggggcaggtagctcagaccattgtcccaacctatcaccctttcccagcctctgtg
ggcaagtaccccacacccccttcccaacacagttatgcctcctcaaatgctgccgagcgc
acccccaatcatggtggtcacctccagggcgagcacccgtacctgacaccatccccagag
tctcctgaccaatggtcgagctcttcaccgcactctgcgtctgactggtcagatgtgacc
accagcccaactcctggagggggtggaggcggtcagcggggacctggaacacacatgtcc
gagccaccacacagcaacatgcaggtttatgcatga

KEGG   Rattus norvegicus (rat): 406162
Entry
406162            CDS       T01003                                 

Gene name
Notch4
Definition
(RefSeq) notch 4
  KO
K20996  Notch 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    406162 (Notch4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    406162 (Notch4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    406162 (Notch4)
   05206 MicroRNAs in cancer
    406162 (Notch4)
  09162 Cancer: specific types
   05224 Breast cancer
    406162 (Notch4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    406162 (Notch4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    406162 (Notch4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Ank Ank_5 Notch Ank_3 Ank_4 EGF_3 EGF_2 NODP NOD cEGF
Other DBs
NCBI-GeneID: 406162
NCBI-ProteinID: NP_001002827
RGD: 1303282
Ensembl: ENSRNOG00000000442
Vega: OTTRNOG00000001714
UniProt: Q6MG89
LinkDB
Position
20p12
AA seq 1961 aa
MQRQWLLLLLLPLSFPVILTRELLCGGSPEPCANGGTCLRLSQGQGTCQCAPGFLGETCQ
FPDPCWDTQLCENGGSCQALLPTAPSSHSPTSPLTPHFSCTCPSGFTGDRCQSPLEELCP
PSFCSNGGHCSVQVSGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCP
TGFEGHICERDVNECFLEPGPCPRGTSCHNTLGSFQCLCPVGQEGPQCKLRKGACLPGTC
LNGGTCQLVPEGDTTFHLCLCPPGFTGLNCEMNPDDCVRNQCQNGATCQDGLGTYTCLCP
KTWKGWDCSEDIDECEAQGPPRCRNGGTCQNSAGGFHCVCVSGWGGEGCDENLDDCAAAT
CALGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLRQPCHVNAQCSTNPLTGSTLCICQPG
YSGPTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFQCLCPPGLEGRLCEVEINECASNPCLNQAACHDQLNGFLCLCLPGF
TGARCEKDMDECSSAPCANGGHCQDQPGAFHCECLPGFEGPRCETEADECRSDPCPVGAS
CLDLPGAFLCLCRPGFTGQLCEVPLCSPILCQPGQQCQDQEHRAPCLCPDGSPGCVPAED
DCPCHHGHCQRSLCVCNEGWTGPECETELGGCLSTPCAHGGTCHPQPSGYNCSCLAGYTG
LTCSEEITACHSGPCLNGGSCSIHPEGYSCTCPPSHTGPHCQTAVDHCASASCLNGGTCM
SKPGTFFCHCATGFQGLHCEKKIHPSCADNPCRNKATCQDTPRGARCLCSPGYTGSSCQT
LIDLCARKPCPHTARCLQSGPSFHCLCHQGWTGSLCDLPLSCQAAAMSQGVEISNLCQNG
GLCIDTGSSYFCRCPPGFEGKLCQDTVNPCTSKPCLHGATCVPQPNGYVCQCAPGYEGQN
CSKVHDACQSGPCHNHGTCTPRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTASCH
SLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEVTTGPPPGFTCRCPEGFEGPTC
SRKAPACGNHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCMHNG
SCTETPGLGNPGFQCTCPPDSPGPRCQRPGANGCEGRGGDGACDAGCSGPGGDWDGGDCS
LGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPPTCTPAYDQYCRDHFH
NGHCEKGCNNAQCGWDGGDCRPEGDDSEGGPSLALLVVLSPPALDQQLLALARVLSLTLR
VGLWVRKDSEGRNMVFPYPGTRAKEELSGTRDSSSWERQAPHTQTPGKETESLGAGFVVV
MGVDLSRCGPEHPASRCPRDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTGSPATR
LPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPQTQQAPHRRRPPL
GEDNIGLKALKPEAEVDEDGVVMCSGPEEGEAEKTASASRCQLWPLRSGCEGLPQAVMLT
PPQECESELPDSDTCGPDGVTPLMSAVFCGGVQSTTVQRLGLGNPEPWEPLLDRGACPQA
HTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLLLA
SRQTAVDARTDDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAVNNAR
AARCLLQTGADKDAQDSREQTPLFLAAREGAVEVAQLLLEIGAARGLRDQAGLAPADVAR
QRSHWDLLTLLEGAGPITQEARSHARNTPGGGAAPRCRTLSAGARPRGGGACLQARTWSV
DLGARRGAVYARCRSRSGGSGGPSMRGRRLSADSRGRRGARVSQDDWPRDWVALEACGSA
CSAPIPPPSLTPSPERGSPQVSWGLPVHQEVPLNSGGRNQN
NT seq 5886 nt   +upstreamnt  +downstreamnt
atgcagcgccagtggctgctgcttctgctcttgccgctcagcttcccagtcatcctgacc
agagagcttctgtgtggaggatccccagagccctgtgccaacggaggcacctgcctgagg
ctatctcagggacaagggacctgccagtgtgcccctggatttctgggtgagacttgccag
ttccctgacccctgctgggacacccaactctgcgagaacggtggcagctgtcaagccttg
ctccccacagccccaagctcccacagccccacttctccactgaccccccacttctcctgc
acctgcccctctggcttcactggtgatcgatgccaaagccctctggaagagctctgtccg
ccttctttctgttccaacgggggtcactgctctgtccaggtctcgggccgcccacagtgt
tcctgcgagcccgggtggacaggtgagcagtgccagctccgagacttctgctcagccaac
ccctgtgccaacggaggtgtgtgcttggccacatacccccagatccagtgtcgttgtcca
accggcttcgagggtcacatctgtgaacgcgacgtcaatgaatgcttcctggagcccgga
ccctgccctcggggcacctcctgtcacaacaccttgggctccttccagtgcctctgccct
gtggggcaggaaggtccccagtgcaagctcaggaagggagcctgccttcctggaacctgt
ctcaatggaggcacctgccagctggtgccagagggagacactacctttcatctctgcctc
tgtcccccaggtttcacagggctgaactgtgagatgaatccagatgactgtgtcaggaac
cagtgtcagaacggggccacctgccaggatgggctgggcacctacacctgcctctgcccc
aagacgtggaagggctgggactgctccgaagacatagatgaatgtgaagcccagggtccg
cctcgatgcagaaacggtggcacctgccagaactcggctggtggctttcactgtgtgtgt
gtgagtggctggggaggcgagggctgtgacgagaacctggatgactgtgcggccgccacc
tgtgccctgggatccacctgcatcgaccgtgtgggctccttctcctgcctctgcccacct
ggacgcacaggcctcctgtgccacctggaagacatgtgtttgaggcagccgtgccatgtg
aatgcccagtgcagcaccaaccccctgacggggtctaccctctgcatatgccagccgggc
tactcgggacccacctgccaccaagatctggatgagtgtcaaatggcccagcaaggaccc
agtccctgtgaacacggcggctcctgcatcaacacccctggctccttcaactgcctctgc
ctgcctggctacacgggctcccgctgcgaggctgaccacaatgagtgcctgtcgcagccc
tgtcacccgggcagcacctgcctggacctgcttgccaccttccagtgcctctgcccacca
ggcctggaagggaggctctgtgaagtggagatcaatgagtgtgcctctaacccctgcctc
aaccaagctgcctgtcacgaccagctcaacggcttcctgtgcctctgccttcctggattc
actggtgccagatgcgagaaagacatggacgagtgcagcagcgccccctgtgccaatggg
gggcactgccaagaccagcctggagccttccactgcgagtgtctcccaggctttgaaggg
ccacgctgtgagactgaagcggatgaatgtcggagtgacccctgccccgtgggagccagc
tgccttgatcttcccggggcgttcctctgcctctgccggcctggtttcacaggtcaactt
tgtgaggttcccttgtgtagccccatcctgtgccaacctggacagcaatgccaagaccag
gaacacagagccccctgcctctgccctgacggaagtcctggctgtgttcctgctgaggac
gactgcccctgccaccatggccattgccagagatccttgtgtgtgtgtaacgagggctgg
actggaccagagtgtgagacagagctgggcggctgcctctccacaccctgtgcccatggg
gggacctgccacccacagccctctggctacaactgtagctgccttgcaggctacacgggg
ctgacctgtagtgaggagataacagcttgtcactcagggccctgtctcaatggtggctcc
tgcagcatccatcctgagggctactcttgcacctgccctccaagtcacacaggtccccac
tgccagactgccgtggaccactgtgcgtctgcctcgtgtctcaacgggggtacctgcatg
agcaaacctggcactttcttctgccactgtgccactggcttccaggggctgcactgtgag
aagaagattcaccccagctgtgcagacaacccctgcaggaacaaggcaacctgccaagac
acacctcgaggggcccgctgcctctgcagccctggctacacaggaagcagctgccagact
ctgatagacttgtgtgcccggaagccctgtccacacactgcccgatgcctccagagtggg
ccctccttccactgcctgtgccaccagggatggacagggtctctctgtgacctcccactg
tcctgccaggcggccgcgatgagccaaggtgtagagatctccaacctgtgccagaatggg
ggcctctgtattgacacgggctcctcctatttctgtcgctgccctcctggattcgagggc
aagttatgccaggatactgtgaacccctgcacgtccaagccttgccttcacggggctacc
tgtgtgccccagcccaacggctatgtctgccagtgtgccccaggctatgaaggacagaac
tgctcaaaagtacacgacgcttgccagtccgggccgtgccacaaccatggaacctgtacc
cccaggcctggaggcttccactgtgcctgccctccaggttttgtggggctgcgctgtgag
ggggatgtggacgagtgtctcgaccggccctgccacccctcgggcactgcgtcctgccat
tctttagccaacgccttctattgccagtgtctgcctgggcacacaggccagcggtgtgaa
gtggagatggacctctgccagagccagccctgctccaatggagggtcctgtgaggtcaca
acaggaccgccccctggcttcacctgccgctgccccgagggttttgaaggccccacctgc
agccgcaaagcccctgcctgcggcaaccatcattgccacaacggaggcctatgtctgccc
tcccctaagccaggctccccacccctctgtgcctgcctcagtggcttcgggggccctgac
tgtctgacacctccagctccaccagggtgcggtcctccctccccctgcatgcacaatggt
agctgcactgagacccccgggttgggcaatcctggctttcaatgcacctgccctcctgac
tctccggggccccggtgtcaaaggccaggggcgaatggatgtgagggccgaggtggcgat
ggagcctgtgatgctggctgcagtggcccaggaggggactgggatggaggggactgttcc
ctgggggtcccagacccctggaagggctgtcccccgcattcccagtgctggcttctcttc
cgggatgggcggtgccacccacagtgcgactctgaggagtgtctgtttgatggctatgac
tgtgagatccctccaacttgcaccccagcctacgaccagtactgccgagatcacttccac
aacgggcactgtgagaaaggctgcaacaacgctcagtgtggctgggatgggggtgactgc
aggccagaaggggatgactcagaggggggcccctccctggccctgctggtggtgctgagt
cccccagccttggatcagcagctgcttgccctggctcgagtactgtccctgactctgagg
gtcggtctctgggtgaggaaggacagtgaaggcaggaacatggtgttcccctatcctggg
acccgggccaaagaggagctgagtggaactagagattcctcttcgtgggaaagacaagcc
cctcacactcagaccccgggcaaagagacagagtcccttggtgcagggtttgtggtagtg
atgggagtggatttgtcccgctgtggtccagagcatcctgcgtcccgctgtccccgggac
tctgggctcctgctgcgtttccttgcagcaatggccgcagtgggagctctggagcccctg
ctgcctggacccttgctggctgctcaccctcaagcagggaccgggtcccccgccacccgg
cttccctggcccattctgtgttcgccagtggtcggggtgctcctcctggcccttggggct
cttctcgtcctccagctcatccggcgccggcggcgggaacacggggccctgtggctgccc
cctggtttcattcgaaggccacagacacagcaggcaccccaccggcggaggcccccactg
ggcgaggacaacattggtctcaaggcgctgaagccagaggcagaagtggatgaggacgga
gtggtcatgtgctcgggccctgaagagggcgaggcagaaaaaacagcctcagcctccagg
tgccagctctggccactgcgcagcggctgtgaagggctcccacaggcagtcatgctgacc
cctcctcaggagtgtgaatcagaacttccagattcggacacctgtggacctgatggggtg
acacccctgatgtctgccgtcttctgtgggggagtgcagtccaccactgtacagagactg
ggactaggaaatcccgaaccctgggaaccactgctggatagaggggcctgcccccaggct
cacactgtgggcactggagagacgcccctgcacctagctgcccgattctctcggccaact
gctgcccgacgcctcctggaggctggagccaaccccaaccagccagaccgggctgggcgt
accccacttcacactgcagtagctgctgatgctcgggaggtttgccagctcctattggcc
agcagacagaccgctgtagacgcgcgcacagacgacgggactacacctttgatgctggct
gccaggttggccgtggaggacctggttgaagaattgatcgcagcccgagcagatgtagga
gccagagataaaaggggaaaaactgcactgcactgggccgctgcagtgaacaacgcccga
gctgcccgctgtctcctccagactggagcggataaagatgcccaggacagtagggagcag
acgccgctgttcctggctgcgcgcgaaggcgccgtggaggtggcacagctgctgctggag
atcggggcagcgcgggggctgcgggaccaggccgggctggccccagcagatgtggcccgc
cagcgtagtcattgggacctgctgacgctgctggagggggcaggaccgatcacgcaggag
gcccgttcgcacgcacgcaacacgccggggggcggggccgcgccgcgctgccggacgctg
tctgccggagcgcgcccgcgcgggggcggagcttgtctgcaagctcgcacttggtcggtg
gacttgggagcgcgccgaggggcggtatacgcgcgctgccggagccgatcaggaggctct
ggaggcccctccatgcgcggccgcaggctttccgcggactcccgtggacgacgcggggct
agagtatcacaggatgactggcctcgggactgggtggccctggaagcctgcggctctgcc
tgcagtgcgccgatcccgcctcccagccttaccccgtccccagaacgcggatcccctcaa
gtttcctggggtcttccagtccaccaagaggtccccttaaactcgggtggaaggaatcag
aactag

KEGG   Rattus norvegicus (rat): 56761
Entry
56761             CDS       T01003                                 

Gene name
Notch3
Definition
(RefSeq) notch 3
  KO
K20995  Notch 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04371  Apelin signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    56761 (Notch3)
   04371 Apelin signaling pathway
    56761 (Notch3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    56761 (Notch3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    56761 (Notch3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56761 (Notch3)
   05206 MicroRNAs in cancer
    56761 (Notch3)
  09162 Cancer: specific types
   05224 Breast cancer
    56761 (Notch3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    56761 (Notch3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    56761 (Notch3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Notch Ank Ank_2 Ank_5 NODP EGF_2 NOD DUF3454 Ank_3 Ank_4 cEGF EGF_3
Other DBs
NCBI-GeneID: 56761
NCBI-ProteinID: NP_064472
RGD: 620761
Ensembl: ENSRNOG00000004346
UniProt: Q9R172
LinkDB
Position
7q11
AA seq 2319 aa
MGPGARGRRRRRRLMALPPPPPPMRALPLLLLLLAGLGAAAPPCLDGSPCANGGRCTHQQ
PSREAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGVARFSCRCLRGFRGPDCS
LPDPCFSSPCAHGAPCSVGSDGRYACACPPGYQGRNCRSDIDECRAGASCRHGGTCINTP
GSFHCLCPLGYTGLLCENPIVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVD
DCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGH
SCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSN
PCHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQ
CGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTFCEVDIDECQSSPC
VNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFE
GTLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCL
DLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEI
NECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFQC
VCDPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFHCTCAPGFQGHQCEVLSPCTPS
LCEHGGHCESDPDQLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGSFRCICH
GGYTGPFCDQDIDDCDPNPCLNGGSCQDGVGSFSCSCLSGFAGPRCARDVDECLSSPCGP
GTCTDHVASFTCTCPPGYGGFHCETDLLDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGTH
CQYKVDPCFSRPCLHGGICNPTHSGFECTCREGFTGNQCQNPVDWCSQAPCQNGGRCVQT
GAYCICPPEWSGPLCDIPSLPCTEAAAHMGVRLEQLCQAGGQCIDKDHSHYCVCPEGRMG
SHCEQEVDPCTAQPCQHGGTCRGYMGGYVCECPTGYSGDSCEDDVDECASQPCQNGGSCI
DLVAHYLCSCPPGTLGVLCEINEDDCGPGPSLDSGLRCLHNGTCVDLVGGFRCNCPPGYT
GLHCEADINECRPGTCHAAHTRDCLQDPGGHFRCICLPGFTGPRCQTALFPCESQPCQHG
GQCRPSLGRGGGLTFTCHCVQPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPG
LSGPSCRVSRASPSGATNTSCAATPCLHGGSCLPVQSVPFFRCVCAPGWGGPRCETPSAA
PEVPEEPRCPRAACQAKRGDQNCDRECNSPGCGWDGGDCSLNVDDPWRQCEALQCWRLFN
NSRCDPACSSPACLYDNFDCYSGGRDRTCNPVYKKYCADHFADGRCDQGCNTEECGWDGL
DCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPY
HRPSPGSESRVRRELGPEVIGSVVMLEIDNRLCLKSAENDHCFPDAQSAADYLGALSAVE
RLDFPYPLRDVRGEPLEPPEQSVPLLPLLVAGAVFLLVIFVLGVMVARRKREHSTLWFPE
GFALHKDIAAGHKGRREPVGQDALGMKNMTKGESLMGEVATDWNDSECPEAKRLKVEEPG
MGAEEPVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASF
CGGALEPMPAEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRL
LDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAV
EGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFL
AAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPSGPHG
LGPLLCPPGAFLPGLKAVQSGTKKSRRPPGKTGLGPQGTRGRGKKLTLACPGPLADSSVT
LSPVDSLDSPRPFGGPPASPGGFPLEGPYATTATTVSLAQLGASRAGPLGRQPPGGCVLS
LGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGSQLLNPATPVSPHERPPPYLAAPGHGE
EYPAAGTHSSPTKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATSA
TAAGALPAQPHPISVPSLPQSQTQLGPQPEVTPKRQVMA
NT seq 6960 nt   +upstreamnt  +downstreamnt
atggggccgggggcccggggccgccgccgccgtcgtcgcctgatggccctgccaccgcca
ccaccgcccatgcgggcgctgcccctgctgctgctgctgctagcggggctgggggctgca
gcacccccttgtctggatggaagcccatgtgcaaatggaggtcgttgcacccaccagcag
ccctcccgggaggctgcttgcctgtgcctgccaggctgggtgggtgagcggtgccagctg
gaagacccttgccactctggcccctgtgccggccgaggcgtttgccagagttcagtggtg
gcgggcgtcgcccggttctcctgtcgttgtctccgtggcttccgaggcccagactgctcc
ctgccagacccctgcttcagcagcccctgtgctcacggtgccccctgctcagttgggtcg
gatggccgatatgcctgtgcctgcccacctggctaccagggtcgcaactgccgaagcgac
atagatgagtgccgagctggtgcgtcttgccgtcacggtggtacctgcatcaatacaccc
ggatccttccactgcctgtgtccacttggctatacagggctgctgtgtgaaaaccccata
gtgccctgcgccccttccccatgccgtaatggtggcacctgtaggcagagtagtgatgtc
acatatgactgtgcttgtcttcctggcttcgagggccagaactgtgaagtcaatgtggat
gactgtcctggacatcggtgtctcaatgggggaacgtgtgtggatggtgtcaatacttat
aactgccagtgccctcctgagtggacaggccagttctgcacagaagatgtggatgagtgc
cagttgcagcccaacgcttgccacaatgggggcacctgcttcaacctactgggcggccac
agctgcgtatgcgtcaacggctggacgggcgagagctgcagtcagaatattgatgactgt
gctacagccgtttgcttccatggggccacttgccatgaccgtgtggcctctttctattgt
gcctgccctatggggaagaccggcctcttgtgtcatctggatgatgcatgtgtcagcaac
ccctgccatgaagatgctatctgtgacacaaaccctgtgagtggtcgggccatctgcacc
tgtccacccggcttcaccggaggggcgtgtgaccaggatgtggatgagtgctctattggt
gctaacccctgtgaacatttgggtcggtgtgtgaacacacagggctcattcttgtgccag
tgtggccgtggctatactggacctcgctgtgagactgatgtcaatgagtgtctgtctggg
ccctgccgcaaccaggccacgtgtcttgaccgaattggccagttcacttgcatctgcatg
gcaggcttcacaggaaccttctgtgaggtggacattgatgaatgtcagagcagcccatgt
gtcaatggtggtgtctgcaaggatagagtcaatggcttcagctgcacctgcccatcagga
ttcagtgggtccacgtgtcagctggatgtggatgaatgtgcaagcactccttgccggaac
ggtgccaagtgtgtggaccagcctgacggctatgagtgtcgctgtgcagagggctttgag
ggcaccctgtgtgagcgaaacgtggacgactgctctccggatccctgtcaccacgggcgc
tgtgtcgacggcattgctagcttctcatgcgcttgtgcgccaggctacacgggcatacgc
tgcgagagccaggtggatgagtgccgcagccagccctgccgatacgggggcaaatgtcta
gacttggtggacaagtacctctgccgctgtcctcccggaaccacaggtgtgaactgcgaa
gtcaacatcgatgattgcgccagcaacccctgtacctttggagtttgccgtgatggcatc
aaccgctatgattgtgtctgtcagcctggattcacagggcccctctgcaacgtggagatc
aatgagtgtgcatccagcccatgtggagagggtggctcctgtgtggacggggaaaatggc
ttccactgcctctgcccacctggctccctgcctccactctgcctacctgcgaaccacccc
tgtgcccacaagccctgtagtcatggagtctgccacgatgcaccaggcgggtttcaatgt
gtgtgcgatcccggttggagtggccctcgttgcagccagagcctggctccagatgcctgt
gagtcccagccctgccaggctggtggcacctgcaccagtgatggaataggcttccactgt
acctgtgcccctggattccagggtcatcaatgtgaggtgctgtccccctgcactccaagt
ctctgtgagcacggaggccactgtgagtctgaccctgaccagctgactgtctgttcctgt
cctccaggctggcaaggccctcgatgccagcaggatgtggatgaatgtgctggtgcctca
ccttgtggcccccatggtacctgcaccaacctgccagggagcttcaggtgcatctgccat
ggaggatacactggccctttctgtgatcaggacattgacgactgtgaccccaacccgtgc
ctcaatggtggctcctgccaggatggtgtgggctccttttcctgttcttgcctcagtggc
tttgctggtcctcgctgtgctcgggatgtggatgaatgtctgagcagtccctgtggccct
ggcacctgcactgatcatgtagcctctttcacctgtacctgtccacctggctatggaggc
ttccactgtgagactgacttgctggactgcagccccagttcctgtttcaatggagggacc
tgtgtggatggcgtgaactccttcagctgtctgtgtcgtcctggctacacaggcacacat
tgccaatataaggttgacccctgcttctcccggccctgtctacatgggggcatctgcaac
cccacccactcaggatttgaatgcacctgccgggagggcttcactgggaatcagtgtcag
aacccagtggactggtgcagccaggcaccctgtcagaatgggggtcgctgtgtccagact
ggggcttactgcatctgtccgcctgaatggagtggccccctgtgcgacataccaagccta
ccctgcacggaggctgcagcccacatgggggtgcggttggagcagctgtgtcaggcgggt
ggccagtgcatagacaaggaccactcccactactgtgtgtgtccggagggccgtatgggt
agtcactgcgaacaggaggtggatccctgcacagcccagccttgccagcatgggggcacc
tgccgtggttacatgggcggctatgtgtgtgagtgtccaaccggctactctggtgacagt
tgtgaggatgatgtggatgagtgcgcttcccagccctgccagaatggaggctcctgtatt
gatcttgtggctcactatctctgctcctgtccccctggcacactgggagttctctgtgag
atcaatgaggatgactgtggcccaggcccatccttggactcaggcctccggtgcctacac
aacggcacctgtgtggacctggtgggtggcttccgctgtaactgtcccccagggtacaca
ggtctgcactgtgaggcggacatcaatgagtgccgacccggcacctgtcatgcagcacat
acccgggactgcctacaagatccaggtgggcacttccgctgcatctgtctccctggcttc
acagggcctcgatgtcagactgctctgttcccctgtgagtcccaaccgtgtcagcatgga
ggccagtgccgtcccagcctaggccgtggaggtgggctgaccttcacctgtcactgtgtc
cagccattctggggtctgcgttgcgagcgggtggcacgctcctgccgggagctgcagtgc
ccagtgggtatcccatgccagcagacagcccgtgggccgcgctgtgcttgtcctcccggg
ctgtctgggccctcctgccgggtttctagggcgtcaccctctggagctactaacaccagc
tgcgctgctactccttgtctgcatgggggctcctgcctacctgtacagagtgtccctttc
ttccgctgtgtatgcgctccgggctggggtggcccgcgttgcgagaccccttccgcagcc
cctgaggtccctgaggagccacggtgcccgcgagccgcctgtcaggccaagcgaggggac
cagaactgcgaccgtgagtgcaacagcccaggctgtggctgggacggcggtgactgctcg
ctgaatgtggacgacccctggaggcagtgtgaggcactgcagtgctggcgtctcttcaac
aacagccggtgcgatccagcctgcagctctcctgcctgcctctatgacaactttgactgc
tactctggtggccgcgaccgcacctgcaacccggtttataagaagtactgcgccgaccac
tttgcagatggccgttgtgaccagggctgtaacaccgaggagtgtggctgggatgggctg
gactgtgccagtgaggtcccggcccttttggcccggggggttctggtcctcacagttctt
ctgcctcctgaagagttgcttcgctctagtgctgacttcctgcagcgactcagcgctatt
ctgcgcacctcgctgcgcttccgcctggatgcacgtggccaagccatggtctttccctac
caccggccaagtcctggctccgaatcccgggttcgtcgtgagcttggcccagaggtgatc
ggctctgtagtgatgctggagattgacaaccggctctgtctgaagtcagcggagaacgac
cactgcttccctgacgcccagagtgctgccgactacctgggagccttgtcggcagtggag
cggcttgatttcccatacccactacgggatgtgcgaggagagcccttggagcctccagag
cagagcgtgccactgctgccgctgctggtggcaggggctgtctttctgctggtcatcttc
gtcctgggtgtcatggttgccaggcgcaagcgagagcacagcaccctctggtttcctgag
ggttttgcattacacaaggacatagctgctggccacaagggccggagggagcccgtggga
caagacgcactgggcatgaagaacatgaccaagggtgagagtctgatgggggaggtggcc
acagactggaatgactcagaatgcccagaggccaagagactgaaggtagaggagccaggc
atgggggccgaggagcccgtggactgtcgccagtggacccaacaccacctggttgctgcc
gatatccgtgtggcaccagccatggcactgactccacctcagggagatgcagatgccgat
ggcatggatgtcaacgtacgagggcctgatggcttcaccccacttatgctggcctcgttc
tgtgggggagccctggagccgatgccagctgaggaggatgaggccgatgacacgtcagcc
agcattatatcagatctgatctgccaaggagcccagctcggggcacgaactgaccgaact
ggcgagaccgccctgcatttggccgcccgatatgctcgagccgatgcggccaagcggcta
ctggatgctggggcagacaccaacgcccaggatcattccggccgcacccctctgcacacc
gcagtgacagctgatgcccagggtgtcttccagattctcatcaggaaccgctccactgac
ctggatgcccgaatggcagatggctctactgcattgatcctggcagcccgcctggcggtg
gagggaatggtggaagagctcatcgccagccacgcagatgtcaatgcagtggatgagctc
gggaaatcggccttacactgggctgcagccgtgaacaatgtggaggctaccttggctctg
ctgaaaaatggagccaacaaggacatgcaggacagcaaggaggagactccactgttcttg
gccgcccgtgagggcagctatgaggctgccaagctgctgctggatcattttgccaaccgg
gagatcacagatcacttggacaggctgccccgggatgtggcccaggagcggctgcaccag
gacattgtgcggttgctggaccagcccagtggcccccgaagtccctctggtccccatggc
ttggggccattgctctgcccaccaggagccttccttcctggcctcaaagcggtgcagtct
gggaccaagaagagcaggaggccacctggcaagactgggctggggccccagggaactcgg
ggtcggggcaagaagctgacactggcctgtccaggccctctggcagacagctctgtcaca
ctgtcaccagtagactcgctggactcaccacggcctttcggtgggccccctgcttcccct
ggaggcttccccttggagggtccctatgccaccacagccaccacggtgtccttggcacag
ctgggtgcaagtcgggcgggtcctctggggcgccagcctcctgggggctgtgtgctcagc
cttggtttgctcaaccctgtggctgttccccttgactgggcccggctgcctccacctgcc
cctccagggccctcattcctgctgcccctggctccgggatcccagctgctcaacccggca
accccagtttctccccatgagcggcccccaccctacctggctgctccaggacatggagag
gaataccctgcagcagggacccacagcagccccacaaaggcccgcttcctgcgggttccc
agcgagcatccttatttgaccccatctcctgagtccccagagcactgggccagcccgtcc
cctccctccctctcagactggtccgactcaacgcctagtccagcaactgctaccagtgcc
acagccgctggagccctgcctgctcaaccacaccccatatctgttccctccctccctcag
tcccagactcagctggggccccagccagaagtaacccccaagaggcaggtgatggcctaa

DBGET integrated database retrieval system