KEGG   Rattus norvegicus (rat): 25741Help
Entry
25741             CDS       T01003                                 

Gene name
Pfkl, ATP-PFK, PFK-L
Definition
(RefSeq) phosphofructokinase, liver type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00030  Pentose phosphate pathway
rno00051  Fructose and mannose metabolism
rno00052  Galactose metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno03018  RNA degradation
rno04066  HIF-1 signaling pathway
rno04152  AMPK signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25741 (Pfkl)
   00030 Pentose phosphate pathway
    25741 (Pfkl)
   00051 Fructose and mannose metabolism
    25741 (Pfkl)
   00052 Galactose metabolism
    25741 (Pfkl)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    25741 (Pfkl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    25741 (Pfkl)
   04152 AMPK signaling pathway
    25741 (Pfkl)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    25741 (Pfkl)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    25741 (Pfkl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25741 (Pfkl)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    25741 (Pfkl)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     25741 (Pfkl)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     25741 (Pfkl)
Messenger RNA biogenesis [BR:rno03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     25741 (Pfkl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 25741
NCBI-ProteinID: NP_037322
RGD: 3311
Ensembl: ENSRNOG00000001214
UniProt: P30835
LinkDB All DBs
Position
20p12
AA seq 780 aa AA seqDB search
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDG
SLTGANIFRNEWGSLLEELVKEGKISESTAQNYAHLSIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQK
AMDEKRFDEAIQLRGRSFENNWKIYKLLAHQKVSKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISEGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKPHLEAI
VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGRGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRDVYRKGRVFANAPDSACVIGLRKKVVAFS
SVTELKKETDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDKGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgtggacctggagaagttgcggatgtcgggggctggcaaggccatcggagtg
ctgacaagcggcggtgacgcgcaaggtatgaatgctgctgtcagggctgtgactcgtatg
ggcatatatgtgggggccaaagtcttcctcatctacgagggctacgagggcctcgtggaa
ggaggcgagaacatcaagccagccaactggctcagtgtctccaacatcatccagctgggc
ggcaccatcattggcagtgcccgctgtaaggccttcactacgagggaagggcgcctggca
gcggcctacaatctgctccaacacggcatcaccaacctgtgtgtcatcggtggggatggc
agcctcacgggggccaacatcttccgcaacgagtggggcagcttgctggaggaactggtg
aaggaaggcaagatctcagagtccacagctcagaactacgcacacttgagcatcgccggt
ctggtgggctccatcgacaacgacttctgcggcaccgacatgaccatcggcacggactcg
gccctgcaccggatcatggaggtcatcgacgccatcaccaccactgcccagagccaccag
aggacctttgtgttggaggtgatgggacggcactgcgggtacctggcgctggtgtctgcg
ctggcctccggggctgattggctgttcatccctgaagcgcccccggaggatggctgggag
aacttcatgtgtgagaggctgggggagactcggagccgggggtctcgactgaacatcatc
atcatcgcggagggtgccatcgaccggcatggaaagcctatctcatccagctacgtgaaa
gacctggtggttcagaggctgggcttcgatacacgagtgaccgtgctgggccacgtacag
cgaggagggacaccctcggcctttgaccgagtcctgagtagcaagatgggtatggaggcc
gtgatggcgctgctggaggccacgccggacacgccggcctgcgtggtcagcctctccggg
aatcagtctgtgcggctgcctctcatggagtgtgtgcaagtgacgaaggatgtgcagaag
gccatggatgagaagaggtttgacgaggccatccagctccgtggcaggagcttcgagaac
aactggaaaatttacaagctcctcgcccaccagaaggtgtctaaggagaagtccaacttc
tccctggccatcctgaatgtgggagctccagcggccggcatgaacgcagccgtgcgctcc
gcggtacgcactggcatctccgagggacacacagtgtacgttgtgcatgatggctttgag
ggcctggccaagggtcaggtgcaagaagtgggctggcatgatgtggcaggttggctagga
cgtggtggctcaatgctggggaccaagaggaccctgcccaagccccacctggaggccatt
gtagaaaatctccgtacctacaacattcatgccctgttggtgatcggtggctttgaggcc
tacgagggtgtgctgcagctggtggaggctagggggcgctacgaggaactctgtatcgtc
atgtgcgtcatcccagccaccatcagcaacaatgtccctggcactgacttcagcctgggc
tcggacacggccgtcaacgctgcaatggagagttgtgaccgcatcaaacaatcggcctcg
gggacaaagcggcgtgtgttcattgtagagaccatggggggctactgtggctacctggcc
actgtgacaggcattgctgtgggcgccgatgccgcctacgtctttgaggaccctttcaac
atccacgacttgaaggccaatgtggagcatatgacagagaagatgaagacagacatccag
aggggcctggtgctccggaacgagaagtgtcacgaacactacaccacggaattcctatac
aacctatactcctcggaaggcagaggtgtgttcgactgcaggaccaacgtgctgggccac
ctgcagcagggtggcgctccaacccccttcgaccggaactatgggaccaaactgggggtg
aaggccatgttgtggatgtcggagaagctgcgtgatgtctaccgcaaagggcgggtgttt
gccaatgctccggactcagcctgtgtgatcggcctgaggaagaaggtggtggccttcagt
tcggtcacagaactcaagaaagagacagattttgagcaccgtatgccgcgggagcagtgg
tggctgaatctgcggctgatgctgaagatgttggcacactaccgcatcagcatggccgac
tacgtgtctggggagctggagcacgtcacacgccgcaccttgagcatagacaagggtttc
tga

DBGET integrated database retrieval system