KEGG   Rattus norvegicus (rat): 26956
Entry
26956             CDS       T01003                                 

Gene name
Ak3
Definition
(RefSeq) GTP:AMP phosphotransferase AK3, mitochondrial
  KO
K00944  nucleoside-triphosphate--adenylate kinase [EC:2.7.4.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    26956 (Ak3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.10  nucleoside-triphosphate---adenylate kinase
     26956 (Ak3)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 Cytidylate_kin AAA_33 Ploopntkinase3
Other DBs
NCBI-GeneID: 26956
NCBI-ProteinID: NP_037350
RGD: 619885
Ensembl: ENSRNOG00000052506
UniProt: P29411
LinkDB
Position
1
AA seq 227 aa
MGASGRLLRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFI
DQGKLIPDDVMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEV
IKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQT
EPVLQYYQKKGVLETFSGTETNKIWPHVYSFLQMKVPETIQKASVTP
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggggcatcggggcggctgctgcgcgccgtgatcatgggggccccgggctccggtaag
ggcaccgtgtcgtcacgcatcaccaaacacttcgagctgaagcacctctccagcggggac
ctgctccgccagaacatgctgcagggcacagaaatcggtgtgttggccaagactttcatt
gaccaaggaaagctcatcccggatgatgtcatgactcggctggccctccatgagctgaaa
aaccttacccagtgtagctggctgttggacggatttccaaggacacttccacaggcagaa
gccctggatagagtttatcagatagacacagtgataaatctcaacgtgccctttgaggtc
attaaactacgccttactgctcgctggattcatcctgccagtggccgagtttacaacatt
gaattcaaccctcccaagactgtgggcatcgatgacctaacgggagaacctctgattcag
cgtgaggacgacaaaccagagacggtgatcaagagattgaaggcgtatgaagcccagaca
gagccggtcctgcagtattaccagaaaaaaggggtgttggaaacattctccggaacagaa
accaacaagatctggccccacgtatactccttcctgcaaatgaaagttccagaaaccatc
caaaaagcctctgttactccctga

DBGET integrated database retrieval system