KEGG   Rattus norvegicus (rat): 287287
Entry
287287            CDS       T01003                                 

Gene name
Il4, Il4e12
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04672  Intestinal immune network for IgA production
rno05140  Leishmaniasis
rno05200  Pathways in cancer
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    287287 (Il4)
   04151 PI3K-Akt signaling pathway
    287287 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287287 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    287287 (Il4)
   04660 T cell receptor signaling pathway
    287287 (Il4)
   04658 Th1 and Th2 cell differentiation
    287287 (Il4)
   04659 Th17 cell differentiation
    287287 (Il4)
   04657 IL-17 signaling pathway
    287287 (Il4)
   04664 Fc epsilon RI signaling pathway
    287287 (Il4)
   04672 Intestinal immune network for IgA production
    287287 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    287287 (Il4)
  09163 Immune disease
   05310 Asthma
    287287 (Il4)
   05320 Autoimmune thyroid disease
    287287 (Il4)
   05321 Inflammatory bowel disease
    287287 (Il4)
   05330 Allograft rejection
    287287 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    287287 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    287287 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    287287 (Il4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   287287 (Il4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Cytokines
   287287 (Il4)
SSDB
Motif
Pfam: IL4 DUF5628
Other DBs
NCBI-GeneID: 287287
NCBI-ProteinID: NP_958427
RGD: 2898
Ensembl: ENSRNOG00000007624
UniProt: P20096
LinkDB
Position
10q22
AA seq 147 aa
MGLSPHLAVTLFCFLICTGNGIHGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATR
NTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLCRGVSGLNSLRSCTVNEST
LTTLKDFLESLKSILRGKYLQSCTSMS
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggtctcagcccccaccttgctgtcaccctgttctgctttctcatatgtaccgggaac
ggtatccacggatgtaacgacagccctctgagagagatcatcaacactttgaaccaggtc
acagaaaaagggactccatgcaccgagatgtttgtaccagacgtccttacggcaacaagg
aacaccacggagaacgagctcatctgcagggcttccagggtgcttcgcaaattttacttc
ccacgtgatgtacctccgtgcttgaagaacaagtctggggttctcggtgaactgaggaaa
ctctgtagaggtgtcagcggtctgaactcactgagaagctgcaccgtgaatgagtccacg
ctcacaacactgaaagacttcctggaaagcctaaaaagcatcctacgagggaaatacttg
cagtcctgcacttccatgtcctaa

DBGET integrated database retrieval system