KEGG   Rattus norvegicus (rat): 287480Help
Entry
287480            CDS       T01003                                 

Gene name
Olr1466
Definition
(RefSeq) olfactory receptor 1466
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    287480 (Olr1466)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    287480 (Olr1466)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    287480 (Olr1466)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx BCD DUF2970
Motif
Other DBs
NCBI-GeneID: 287480
NCBI-ProteinID: NP_001000024
RGD: 1333989
LinkDB All DBs
Position
10q24
AA seq 314 aa AA seqDB search
MIEENQTVISQFLLMGLPIPSEHQQLFYALFLSMYLTTVLGNLIIIILICLDSHLHTPMY
LFLSNLSFSDLCFSSVTMPKLLQNMQSQDTSILYAGCLTQMYFFLLFGDLESFLLVAMAY
DRYVAICFPLHYVSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDNVIPHFFCD
MSALLKLSCSDTHVNELVIFVMGGIILVIPFVLIIVSYVRIVSSILKVPSARGIRKAFST
CGSHLSVVSLFYGTVIGLYLCPSANNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKGA
LNRVICKKKVFFCL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagagaaccaaactgtgatctcccagttccttctcatgggtctgcccatccct
tcagagcaccagcaactgttctacgccctgttcctgtccatgtacctcaccactgtcctg
gggaacctcattatcatcatcctcatttgtctggattcccatctccacacacccatgtac
ttgtttctcagcaacttgtccttctctgacctctgcttttcctctgtcacaatgcccaaa
ttgttgcagaacatgcagagccaggacacatccatcctctatgcaggctgcctgacacaa
atgtactttttcttgctttttggagatctcgagagcttcctgcttgtggccatggcctat
gaccgctatgtggccatctgcttcccccttcattacgtgagcatcatgagccccaagctc
tgtgtgagtctggtggtgctgtcctgggtgctgactaccttccatgccatgctgcacacc
ctgctcatggccagattgtcattctgtgaggataatgtgatcccccactttttctgtgac
atgtctgctctgctgaagctgtcctgctctgacacccatgttaatgagttggtgatattt
gtcatgggaggcatcatccttgtcattccatttgtgctcatcattgtgtcctatgtccga
attgtctcctccattctcaaggtcccatctgctcgaggcatccgtaaagccttctccacc
tgtggctcccacctgtctgtggtgtcactgttctatgggacagtcattggtctgtactta
tgtccatcagctaataactctactgtgaaggagactgtcatggccatgatgtacacggtg
gtgactcccatgctgaatcccttcatctacagcctgaggaacagagacatgaagggagca
ctgaacagagttatttgtaagaagaaagttttcttctgtctatga

DBGET integrated database retrieval system