KEGG   Rattus norvegicus (rat): 287643
Entry
287643            CDS       T01003                                 

Gene name
Spop
Definition
(RefSeq) speckle type BTB/POZ protein
  KO
K10523  speckle-type POZ protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    287643 (Spop)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    287643 (Spop)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     287643 (Spop)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 287643
NCBI-ProteinID: NP_001093966
RGD: 1311613
Ensembl: ENSRNOG00000004686
UniProt: B2RYD9
LinkDB
Position
10q26
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagggttccaagtcctccacctccggcagaaatgtcgagtggtcctgttgctgag
agctggtgctatacacagatcaaggtagtgaagttctcctacatgtggaccatcaataac
tttagtttttgccgggaggaaatgggtgaagtcataaaaagttcaactttttcatcagga
gccaatgataagctgaaatggtgtttgcgagtaaacccgaaggggctggatgaggaaagc
aaagattacctgtcgctctacctgttgttggtcagctgtccaaagagtgaggttcgggcc
aagttcaagttctccatcctgaatgccaagggagaagaaaccaaagctatggagagccag
cgagcttataggttcgtgcaaggcaaagactggggattcaaaaaattcatccgtagagat
tttctcttggacgaggccaatggacttctccctgatgacaagctcaccctcttctgcgag
gtgagtgtagtccaagactctgtcaatatctctgggcagaatactatgaacatggtaaag
gtccctgaatgccggttggctgacgagttaggagggctgtgggagaactctcgattcaca
gactgctgcttgtgtgtggctggccaagaattccaggctcacaaggctatcttagcagct
cggtctccagttttcagtgccatgtttgaacatgaaatggaggagagcaaaaagaatcgg
gttgaaattaacgatgtagaacctgaagtttttaaggaaatgatgtgcttcatctacacg
gggaaggcaccaaaccttgacaaaatggctgatgatttgctggcagctgctgacaagtac
gccctggagcgtttgaaggtcatgtgcgaggatgccctctgcagtaacctctctgtggag
aacgctgcagagattctcatcctggctgacctccacagcgcagatcagctgaaaacccag
gcagtggatttcatcaactatcatgcttcggatgtcttggagacctctgggtggaagtca
atggtggtgtcacatccccacttagtggcagaagcgtaccgctctctggcttccgcacaa
tgccctttcctggggcccccgcgcaaacgcctgaagcaatcctaa

KEGG   Rattus norvegicus (rat): 296532
Entry
296532            CDS       T01003                                 

Gene name
Spopl, RGD1305847
Definition
(RefSeq) speckle type BTB/POZ protein like
  KO
K10523  speckle-type POZ protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    296532 (Spopl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    296532 (Spopl)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     296532 (Spopl)
SSDB
Motif
Pfam: BTB MATH
Other DBs
NCBI-GeneID: 296532
NCBI-ProteinID: NP_001127919
RGD: 1305847
Ensembl: ENSRNOG00000005070
UniProt: B2RZC7
LinkDB
Position
3p13
AA seq 392 aa
MSREPTPPLPGDMSTSPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDEESRDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNVSGHTNTNTLK
VPECRLAEDLGNLWENTRFTDCCFFVRGKEFKAHKSVLAARSPVFNAMFEHEMEECTKNR
VEINDLDPEVFKEMMRFVYTGKAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNNNQATDIMETSGWKSMI
QSRPHLVAEAFRALASSQCPQFGIPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtctcgggaacctacccctcctctgcctggagatatgtctactagtcctgttgcggaa
agctggtgctacacacaggttaaagtagtgaaattttcctacatgtggactattaataac
ttcagtttttgtcgagaagaaatgggtgaagtgttaaagagttcaacattttcttctggc
ccaaatgataaaatgaaatggtgcctgagggtaaacccaaaaggcctagatgaggaaagt
agagactacttgtccttgtatttgcttctggtcagctgcccgaagagtgaggttcgagct
aaattcaaattttctcttctgaatgctaaaagggaagaaacaaaagcaatggaaagccaa
agagcatatcgatttgtacaggggaaggattggggatttaaaaaattcattagaagggat
tttttgcttgacgaagctaatggtctccttccagatgacaagcttacgttattctgtgag
gtgagtgtggtccaagattcagtaaatgtatcaggacatactaatacaaacactttgaag
gtgccagaatgtcggctagcagaagacttagggaatctttgggaaaacacaagatttaca
gattgctgcttttttgtgagaggaaaagaattcaaagctcataagtcagtgcttgcagct
cgatccccagtttttaatgcaatgtttgaacatgaaatggaagaatgcacaaagaatcga
gtggaaataaatgatttagaccctgaggtttttaaagaaatgatgagattcgtttacaca
ggaaaggcaccaaatcttgataaaatggctgacaacttgttggcagctgcagataaatat
gcactggaacggctgaaggtcatgtgtgaagaagctttgtgtagtaacctctcagtagaa
aatgttgctgatacccttgtccttgcagatttgcacagtgcagaacagttgaaagcccag
gcaatagactttattaataggtgcagtgttcttcgacaacttgggtgtaaggatgggaaa
aactggaacaacaaccaagcaactgacataatggaaacatcagggtggaagtccatgatt
cagtctcgtcctcatttagtggcagaagccttccgagcacttgcttcttcacagtgtcca
cagtttggtattccacgcaaaaggttaaagcagtcttga

DBGET integrated database retrieval system