KEGG   Rattus norvegicus (rat): 288611Help
Entry
288611            CDS       T01003                                 

Gene name
Wbscr17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00512  Mucin type O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    288611 (Wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    288611 (Wbscr17)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     288611 (Wbscr17)
Glycosyltransferases [BR:rno01003]
 O-Glycan biosynthesis
  Mucin-type
   288611 (Wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 288611
NCBI-ProteinID: NP_001020283
RGD: 1563452
UniProt: Q5CD99
LinkDB All DBs
Position
12q12
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVIFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNPIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgaggagagtcaaagtgttgttggtgttgaacttgatcgcggtggccggc
ttcgtgatctttttggctaagtgtcggcctatcgcggtgcgcagcggagacgccttccac
gagatccggcctcgcgcagaggtggccaacctcagcgcgcacagtgccagccccatccag
gatgcagtcctgaagcgcttgtcgctgctggaggacatcgtctaccggcaacttaatggc
ttatctaaatccctcgggctcatcgaagggtatggtgggcggggcaaaggaggccttcct
gccaccctttccccctctgaagaagaaaaagccaaaggacctcatgagaagtatggctac
aattcctacctcagtgaaaagatctccttggaccggtctattccagattatcgccctacc
aagtgtaaggagctcaaatactccaaggagttaccccagatatccatcatcttcatcttc
gtgaatgaggccctgtcagtgatactgcggtcagtccacagcgccgtcaatcacacgccc
acacacctgctgaaggagattatcctggtggatgacaacagcgatgaagaggagctgaag
gcccccctggaggaatatgtccacaaacgctatcctgggctggtgaaggtggtacgcaat
caaaagagagagggcctgatccgagcacgcatcgagggctggaaggtggccactggccag
gtcactggctttttcgacgctcacgtggaattcactgctggctgggctgagcccgttctg
tcccgcatccaggaaaaccggaagcgggtcatcctcccctccatcgacaacatcaagcag
gacaacttcgaagtacagcgctatgagaactccgcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccgaaagactggtgggacgccggagatccctctctccccatc
aggacaccagccatgattggctgctcgtttgtggtcaacaggaaattctttggtgaaatt
ggtctgctggaccctgggatggatgtgtatggaggagagaatattgaacttggaatcaag
gtatggctctgtggcggcagcatggaggtccttccgtgttcaagggtggcccacattgag
cggaagaagaaaccgtataacagcaacatcggcttctataccaagaggaacgcactccga
gtagccgaggtctggatggatgactacaagtcacatgtgtacatagcgtggaatctgcct
ctggagaatccaggcatcgatatcggcgacgtctcagaaagaaaggcattaaggaaaagt
ttgaagtgtaagaacttccagtggtacttggaccatgtttacccggaaatgagaagatac
aacaacaccatcgcatacggggagcttcgtaataacaaggccaaggatgtctgcctggac
caggggccactggaaaaccacacagcaatactctacccatgccacggttggggaccacag
ctcgcccgctacaccaaggaaggcttcctgcacttgggtgctctggggaccaccactctc
ctccctgatacccgctgcctggtagacaactccaagagccggttgccgcagctcctggat
tgtgacaaggtcaagagtagcttgtacaagcgttggaacttcatccagaatggagccatc
atgaataagggcacagggcgctgcctagaagtggagaaccggggcctggccggtatcgac
ctaatccttcggagctgtacaggacagagatggacaatcaagaatcccattaagtag

DBGET integrated database retrieval system