KEGG   Rattus norvegicus (rat): 289276
Entry
289276            CDS       T01003                                 

Gene name
Adss
Definition
(RefSeq) adenylosuccinate synthetase isozyme 2
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00250  Alanine, aspartate and glutamate metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    289276 (Adss)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    289276 (Adss)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     289276 (Adss)
SSDB
Motif
Pfam: Adenylsucc_synt Spore_YpjB
Other DBs
NCBI-GeneID: 289276
NCBI-ProteinID: NP_001099445
RGD: 1310508
Ensembl: ENSRNOG00000004481
UniProt: D4AEP0
LinkDB
Position
13
AA seq 456 aa
MSISESSPAATSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
DGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQQLKGYMERIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGETIPHFPANQEVLNKVEVQYKTLPGWNTDISNARTFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgtcgatctctgagagcagcccggcggctacttccttgccgaacggcgactgcggccgc
cccagggcgcggcctggagggaaccgggtgactgtggtgctgggagcgcagtggggcgac
gagggcaaagggaaggtggtggatctgctggcgcaggacgccgacatcgtgtgccgttgc
cagggagggaataacgctggccacacagttgtcgtagactcggtggagtatgactttcac
ctcttacctagtgggataatcaacccaaatgtcactgccttcattggcaatggagtggta
attcatcttcctggactgtttgaagaagcagagaaaaatgttcaaaaggggaaaggtcta
gatggctgggaaaaaaggcttatcatatcggacagagctcatattgtgtttgactttcat
caagcagctgatggtatccaggaacagcagagacaagagcaagcaggaaaaaatttgggt
accacgaaaaagggtatcggccctgtatattcctctaaagctgctcggagtggacttcgg
atgtgtgatcttgtttctgacttcgatggcttctctgagaggttcaaagttctagctaac
cagtataaatctatatatccgactttggaaatagacattgaaggtgaattacaacaactc
aagggttatatggaaaggattaaaccgatggtgagagatggagtttatttcctatatgag
gccctccatggaccccccaagaaaatcttggtagaaggtgcgaacgcagcactgttagat
attgactttggaacttacccttttgtaacctcttcaaactgcactgttggaggtgtctgt
acaggtctgggtatgccccctcaaaatgttggagaagtgtatggagttgtgaaagcttac
accactagagttgggattggtgcctttcccacagagcaagacaatgaaattggagaatta
ttacaaacacggggtagagaatttggagtaactactgggaggaaaagaagatgcggctgg
ttggaccttgtcttactcaaatacgctcacatgatcaatggatttactgcgttggccctt
accaagttggatattttggatatgtttacggagatcaaagtcggagttgcttacaaatta
gatggggaaaccatacctcatttcccagcaaaccaagaagtcttaaataaagtggaagtt
cagtataagactctcccaggatggaacacagatatatctaatgcaaggacatttaaggag
ctacctgtcaatgcacaaaattatgttcggtttattgaagatgagcttcaaataccagtt
aaatggattggtgtgggtaaatccagagagtccatgattcagctcttctaa

KEGG   Rattus norvegicus (rat): 684425
Entry
684425            CDS       T01003                                 

Gene name
Adssl1
Definition
(RefSeq) adenylosuccinate synthetase isozyme 1 isoform X1
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00250  Alanine, aspartate and glutamate metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    684425 (Adssl1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    684425 (Adssl1)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     684425 (Adssl1)
SSDB
Motif
Pfam: Adenylsucc_synt MBF1
Other DBs
NCBI-GeneID: 684425
NCBI-ProteinID: XP_003750285
RGD: 1590342
Ensembl: ENSRNOG00000046763
UniProt: M0R629
LinkDB
Position
6
AA seq 457 aa
MSGTRASNDRPPGTGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIV
SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKG
LKDWEKRLIISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGL
RICDLLSDFDEFSARFKNLAHQHQSMFPTLEIDVEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKA
YTTRVGIGAFPTEQINEIGDLLQNRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALA
LTKLDILDVLSEIKVGISYKLNGKRIPYFPANQEILQKVEVEYETLPGWKADTTGARKWE
DLPPQAQSYVRFVENHLGVAVKWVGVGKSRESMIQLF
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgtccgggacccgagcctccaacgaccggccccccggcacaggcggagtcaagaggggg
cggctgcagcaggaggcggcggcgacaggctcccgcgtgaccgtggtgctgggcgcgcag
tggggggacgagggcaaaggcaaggtggtggacctgctggccacggacgccgacatcgtc
agtcgctgccaggggggcaacaatgccgggcacacagttgtggtggatggcaaggaatat
gacttccacctgttacccagcggcatcatcaacaccaaggccgtgtcgttcattggcaat
ggtgtggtcatccacttgccaggcttgtttgaagaggcagagaagaacgagaagaaaggg
ctgaaggactgggagaagcggctcatcatctctgaccgggctcaccttgtgttcgacttc
caccaggcagtggacgggctgcaggaagtgcaacggcaagcacaagaggggaagaatatc
ggcaccaccaagaagggaatcggaccaacttactcctccaaggctgcccggacgggcctc
cgcatctgtgacctcctgtcggattttgatgagttttctgccagattcaagaacctggcc
caccagcaccagtctatgttccccaccctggaaatagatgtggaaggtcaactcaaaagg
ctcaagggttttgctgagcggatcagacccatggttcgggacggtgtctacttcatgtat
gaggcactccatggtccccccaagaagatcctggtggaaggcgccaacgccgccctgctt
gacattgacttcgggacctacccttttgtgacttcttccaactgcactgtgggtggcgtg
tgcacaggcctgggcatcccgccccagaacataggtgatgtgtacggtgtggtaaaagcc
tacaccacccgcgtgggcattggtgccttccccacggaacagattaacgaaattggagat
ctgctgcagaaccgtggccatgagtggggcgtgaccacgggcaggaagaggcgctgtggc
tggctggacctgatgatcctccgatacgctcacatggtcaacggcttcactgcgctggcg
ttgaccaagttggacatactggatgtcctgagcgagattaaagttggtatctcctacaag
ctcaacgggaagaggatcccctacttccctgctaaccaggagatattgcagaaggtggag
gtggagtatgaaacactccctggatggaaggctgacaccacgggggccaggaagtgggag
gacctgcccccgcaggcccagagctatgtgcggttcgtggagaatcacttgggtgttgca
gtcaaatgggttggcgttggaaagtccagagagtccatgatccagttgttttag

DBGET integrated database retrieval system