KEGG   Rattus norvegicus (rat): 289711
Entry
289711            CDS       T01003                                 

Gene name
Evc2
Definition
(RefSeq) EvC ciliary complex subunit 2
  KO
K19608  ellis van creveld syndrome protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    289711 (Evc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    289711 (Evc2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    289711 (Evc2)
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 289711
NCBI-ProteinID: NP_001099482
RGD: 1310417
Ensembl: ENSRNOG00000007025
UniProt: D3ZWN3
LinkDB
Position
14q21
AA seq 1217 aa
MGATGLTGTGGQATWVLAGNILAAALVLGVGPCALPPSFPALGPGSPSPPDPVGPRASSQ
HSDISRDAQGPSENGVIFQKCSLVSGQSESQTMHVQLSVNNTRTPMSANLSDLLVLDDIT
GLTVKESPGNVTQEGIQTFRKRFLQVGECYSVSYMASLDPTALGPGESLDLPAQLIFQRP
SQNRTQLRARFTITVEEKIMVLPNHGLHTAGFIAAFLISFLLTLAALFFLARGRCLQGSM
LLRCRVQHPENKLEPSPFTSANGVSQDLSLNDQLVAILTSEEPGSMLQALEELEIATLNQ
ADADLEACRNQISKDIIALLMKNLISGGHLSLQTERKMAAAFKKQFLLLENEIQEEYERK
MLALTAECDLEVRKKTENQYQREMVAMEEAEEVLKRVSERSAAECSSLLRTLHGLEQEDL
QRSLTLQQAEDFAQAHRQLAVFQRNELHSIVYTQIQSAVAKGELRPEVAKMLLQDYSKTQ
ESIEELMDFFQATKRYHLSKRFGHREYLVQRLQAMETRVQGLLSTAATQLTSLIHKHERA
GYLDEDQMEMLLERAQTETFSIKQKLDNDLKQEKKRLHQKLITKRRRELLQKHKEQQKEQ
VSLGEASSTAEDAIQYLQQWRSVMAEHTTALEELQERLDQAALDDLRVLTVSLSEKATEE
LRRLQSTAMTQELLKRSAPWLFLQQILEEHSRESAARTAQLEAEERERGQELVQGVRQRL
QQDAPEACTEEQAELRHWEHLVFTKLCSAAISLSEEDLLRVRQEAQGCFTQLDRSLALPR
VRARVLQQQMQMTWREAEFRKLDQALAVPELQSKSRKLRSKGRGKADLLKKNLEDKIRLF
EERAPEDLADQVRGELLQERVQRLEAQEAHFAESLVALQFQKVARAAETLSVYTALLSIQ
DLLLGELSESETLTKSACVQILESHRPELLELERMLEDRLVQQEEAEQRRVLESRQRWAA
DGPALGEPEEIDPERQVSAVLRQALNKGQKLLEQYQQRVREEQQNGAVLEDSLESMETDT
MASLCSQGLRLVSYLSRMTMVPGGTLLRLLSVVLPAASQPQLLALLDAVSEKHSDHTAEN
ESGGEQAQAEQGKRRKHQSWWKALDSRFRADLVSQGLERMLWARRKKESILKKRYVPVQE
RVVFPGKGSWPHLSLEPIGELAPIPITGLDTMDILNTGEKIFVFRSPKEPEISLRVPPRR
KKNFLNAKAASRALGLD
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgggggcgaccggtctcacgggcactgggggacaagccacgtgggtgctggctggaaat
atcctggccgcggccttggtactgggtgtgggtccgtgtgcgcttccaccctccttccct
gccctgggcccagggtcgccatccccacccgaccctgtaggaccccgggcaagctcacag
cacagcgatatttcaagagatgcccaaggtccctcagagaacggagtgatatttcaaaaa
tgctcgctggtgtctgggcagagcgaatcgcagaccatgcatgtgcagctgtcagtgaac
aacaccaggacgcccatgtcagccaacctttcggacctgcttgtgctggatgacatcact
ggcctcactgtgaaggagtcacctggaaatgtgactcaggaaggaatccagacttttaga
aagcggtttctgcaagtgggagagtgctactccgtcagctacatggcctcgctggacccc
acagcccttgggcctggagagagcctggatcttcccgcccagctcatctttcagagaccc
tcacagaacagaactcagctaagagcccgctttaccatcaccgtggaagaaaagataatg
gttctgcctaaccatggtctccacacagcaggcttcatcgcagccttcctcatctccttc
ctcctgaccttggcagccctgttcttcctggctcggggtcggtgtctgcagggaagcatg
ctgttgagatgccgggttcagcatcctgagaacaagctggagccctcacccttcacctct
gctaatggtgtgagccaggacctttccctcaatgaccaactggttgccatcctgacttct
gaggagcctgggagcatgcttcaagccctagaagagttggagatcgcaaccctgaatcag
gcagatgcggatctggaggcttgtcgaaaccagattagtaaggacatcattgcccttctg
atgaagaatctgatcagtggtggtcacctctctctgcaaacagaaaggaagatggctgct
gcttttaaaaagcagtttctgctgctggaaaacgaaatccaggaggagtatgagcggaag
atgttggcactcacggcagagtgtgacctagaagtgaggaagaagacagaaaaccagtac
cagagggagatggtggccatggaggaagcagaagaggtgttaaagcgagttagtgagagg
tctgctgcagagtgcagcagccttttgcggaccctccatgggctggagcaggaggacctg
cagaggtccctcactctgcagcaagcagaggactttgcccaagcacacaggcagctggct
gttttccagagaaacgaattacacagcatcgtctatacccagatacagagtgctgttgcc
aaaggagaactgaggcccgaggtggctaaaatgctgctgcaagactattctaaaacacag
gagagtatagaagagctgatggacttcttccaggccaccaagcgataccatctcagcaag
aggtttggccacagagagtacctggtccagagactgcaggccatggagacccgcgtgcaa
gggctgctgagcactgcagctacccagctaacaagtctcattcataaacatgagagggct
ggttacttggatgaagatcagatggaaatgctattggagcgtgcacagacagaaaccttt
tctataaaacagaagctggacaatgacttaaagcaagaaaagaaaaggctccaccaaaaa
ttaataaccaagagacggcgagaacttctgcaaaagcacaaggagcagcagaaagagcag
gtgtcccttggcgaggcctccagcactgcggaggatgccattcagtacctgcagcagtgg
aggagcgtgatggccgagcacaccactgccctggaggagctgcaggagcggctggaccag
gctgccctggatgacctccgggtcctgactgtgtcactgtctgagaaagccacagaggag
ctgaggcgcctgcagagcacggccatgacacaggagctgctgaagcgcagtgctccctgg
ctcttcctgcagcagatcctagaggagcatagccgggagtctgcggcccgtaccgcgcag
ctggaggcagaggagagagagcgtggccaggagctggtgcagggcgtgagacagaggcta
caacaggatgcaccggaggcttgcacagaagagcaggcagagctgaggcattgggagcac
ttggtattcacgaagctctgctctgcggccatctcactgtctgaagaagacctgctccgg
gtgaggcaggaggcacagggctgcttcacccagctggaccggagcttggccctccccaga
gtccgtgcacgggtgctgcagcagcagatgcagatgacctggcgggaagcagagttccgg
aaactggaccaggctctggctgtgcctgagctgcagtccaagtcaagaaagctgcgttcc
aagggcagaggcaaggcggaccttctgaagaagaacctggaggataagatccgcctgttc
gaggagcgggcccctgaagacctggctgaccaggtacgaggggaattgctccaggagagg
gtccagaggctggaggcccaggaggcacactttgccgagtcacttgtggctctgcagttc
cagaaggtggcccgggctgctgagaccctctccgtctacaccgccctgcttagcatccaa
gacctgctgctgggggagctgagtgagtcggagacactgaccaagtcagcctgcgtgcag
atcctggagtcccacaggccggagctgctggagctggagaggatgctggaggaccggctg
gtgcagcaggaagaggctgagcagcggcgggtcctggagagcaggcagcggtgggcggct
gacggacctgcgctgggcgagcctgaggagatagatcccgagaggcaggtctctgccgtc
ctgcggcaggctctgaacaagggccagaagctactggaacagtatcagcagagggtgaga
gaggagcagcagaacggtgcagtgctggaagattctctggaaagcatggagaccgacacc
atggccagcctctgcagccagggactgaggctggtgtcctacctctccaggatgacaatg
gtgccggggggcaccctactgagactcctgagtgtggtgcttcccgcagcttcacagcct
cagctactggccttgctggatgcagtcagcgagaagcactcagaccacacagcagagaat
gagagtggtggtgagcaggcacaggcggagcagggcaagaggagaaaacaccagagctgg
tggaaagctttggacagcaggttcagagcagatctggtgagtcaaggactggagaggatg
ctctgggcccgccggaagaaggagagcatattgaagaagagatatgttcctgtccaggag
agggtggtgttccccgggaaaggaagctggccgcacctgtccctagagcccatcggagaa
ctggcgcccatccccatcacagggctagacactatggacatattaaacacaggagaaaag
atctttgtattcagaagcccaaaggagcctgagatctctttgcgtgttcctcccagaagg
aagaagaatttcctgaatgccaaggcagccagcagggccttgggcttggactga

KEGG   Rattus norvegicus (rat): 289712
Entry
289712            CDS       T01003                                 

Gene name
Evc
Definition
(RefSeq) EvC ciliary complex subunit 1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    289712 (Evc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    289712 (Evc)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    289712 (Evc)
SSDB
Other DBs
NCBI-GeneID: 289712
NCBI-ProteinID: NP_001163910
RGD: 735186
Ensembl: ENSRNOG00000007564
UniProt: G3V706
LinkDB
Position
14q21
AA seq 1003 aa
MTCRRDARLQLGREALQAAPTLLVPAVLLGALLGLGLGLWLGCRARRLRARLQKDDTKHL
LRSSEPPAQSLRDTSSKARRRQRETTRDEDAPEVCEPSLSGNITAFALKARVVYPINQKF
RPLADGSSHPSLHENLTQAAAILPHLPHQPAEASPASSLGSLSQAGKEDGSSSSSMQSTY
SDDRVLQCAFLRVGSFPEILAYESVDIDLCVCSLHLKDLLQVDAALRQEKHLMFLQILKA
CLLECFPKKKPEEELYQKILSKQEHDLEELEKGLQARLANTEMLGTGDSGYISLADVERK
ERELSEQLIDNMGAFWKQMESMQPILMDQLKCSSSKARQLMMTLTGRMIVAEGLLHESQD
LHVLDTLERTMGRAHMARIVEFLRTQIQEETKCRLAAISRGLELLTVQGQLSGRQKEELL
TQQHKAFWEEAECFGREFMQRGKDLVQVSQAHRAEAVAELTRAQEEERRIFLADTQPTSD
PEEFLKAFHEVLERQRLTRSDQEGEEDTRITEAMAALCQELYCGTMETFQKFVDTLFLKT
LPEVSSLPVAECEALRQQVQEQAARQLGQADRFRRRQWGLLCDLLEQDKRVWLEECTLST
VLQRQLRDHHESTIHGVLSRFSGLSEESTRGILQGHELLLCSALRRLALRGTTITALAQM
RLSGKKRLLQELHEQLALEQGVSPCLEEHQWQLLRALEARILEETARLEDEAQQTALRLQ
QQLLAEAQEAGQLLQLHSERAIGQALLVHARNVASKGRTRDKEDFKRTLVETVVESVYVT
STSVNRLVQVHYQGIGKLLQAHEEQLLQRLKTLQDERINAYKLWKKQEFSDPPSESQTPG
GTHGAPQAVQQRMTSQRKKLLDQFTKHQQGRLNSQRQKAQELDQLEAQLETQLQEAEQTL
ISELATLARVPLAENKPFSNKRGLPEKPVRTKRKKPPPREREDLGLPNDDHPALADHSTG
PLSAVYSASPPILVHSNGKLGQQDGEACDGENTRKILQKRSNL
NT seq 3012 nt   +upstreamnt  +downstreamnt
atgacctgcaggagagatgcgcgactgcagctgggccgggaagccctgcaggcggcgcct
acgctgctggtccccgcagtgctactgggtgccttactcggcctgggcctcggcctgtgg
ctcggctgtcgtgcgaggcgcttgcgcgcgcggctccagaaagatgacacaaaacatctg
ctcaggagttcggagccccctgcacagagcctccgggatactagctccaaagccaggagg
cgacagagagaaaccactcgagatgaagatgctcctgaggtgtgtgagccgtccttgagt
ggcaacatcacggcctttgcactgaaagccagagttgtctatcccatcaaccagaagttc
cggcctctggctgacggatcctcccacccatcgctgcatgaaaacctgacacaggcagca
gccatcctgcctcaccttccccaccagccggcagaggcctcgccagccagcagtctgggc
agcctgagccaggctggcaaggaggatggcagctcctcctccagcatgcagtcaacctac
agcgacgacagggtcctccagtgtgccttcctccgggtgggcagcttccctgagattctg
gcctatgagagtgtagatattgacctgtgtgtctgcagccttcacctgaaagacctgctt
caggtagacgcggcgctgaggcaggagaagcacctgatgttccttcagattcttaaagca
tgcctcctggaatgttttcctaaaaagaagcctgaggaggaattataccagaagattctt
tccaaacaagaacatgatttggaggaattagaaaaaggacttcaggccagattggcaaac
acagaaatgttaggtaccggcgactctggctacatttccctggcagatgtggagaggaag
gagagagagctctcagagcagctcatagacaatatgggagctttctggaagcagatggaa
agcatgcagcccattctcatggaccagcttaagtgttccagctccaaggcacggcagctc
atgatgactctgacgggaagaatgattgtcgctgaaggactgctgcatgagtctcaggac
ctgcatgtcctggacactctggagaggacaatgggtcgagcccacatggcaagaattgta
gagttcctgaggacccagatccaggaggagaccaagtgccggctggccgccatctcccgt
ggcctggagctgctgactgtccaggggcagctgtctgggaggcagaaggaggaacttctg
acccaacagcacaaggccttctgggaggaggcagagtgctttggcagggagtttatgcag
cggggcaaagacctggtccaggtgtctcaggctcaccgggcagaggcagtggcagagctc
acacgggcccaagaagaagaacggaggattttcctggctgatacccagccaacctcagat
ccggaagagttcctcaaggcttttcatgaggtactggagaggcagcggctgacacggagt
gaccaggagggggaggaggacaccaggatcactgaggccatggctgcgctctgccaggag
ctctactgtggcaccatggaaacgttccaaaagtttgtggacaccctgtttctgaagacc
ctcccggaagtgagcagcctccctgtggcagaatgcgaggccctgaggcaacaggtccag
gaacaggcagcaaggcagctggggcaggcagaccgattccgcagacgacagtgggggctc
ctgtgtgacctcttggagcaggacaaacgggtgtggctggaggagtgcacgctctccaca
gtgctgcagaggcagctgcgggatcaccacgagagcaccatccacggggtcctgagcaga
ttcagtggcctctcggaagagtccacacgaggcatcctgcagggacatgagctgctgctg
tgctctgctctgcgcagactggccctccgaggtaccaccatcactgccctggctcagatg
aggctgtctgggaagaagaggctcctgcaggagctacatgagcagctagctttagagcag
ggtgtgtccccatgcctggaggagcatcaatggcagctgctcagagccctggaggcacgg
atcctggaggagacagccaggttggaggatgaggcacagcagaccgctctgcggctccag
cagcagctgctggcggaggcacaggaagcagggcagctgttgcagctgcactcggagcgg
gccattgggcaggcgctgctggtacatgctaggaatgtagccagcaaaggccggaccagg
gataaggaagactttaagaggacgctggtggagacagtggtggagagtgtgtatgtgacc
agcactagtgtcaaccgccttgtgcaggtgcattaccagggcatcgggaagctcctgcag
gcccatgaagaacaattgctgcagcgcctgaagaccctacaggatgagagaatcaatgct
tacaagctgtggaagaagcaagaattcagtgacccaccatcagagagccagacaccaggc
ggtacccatggagcgccccaggctgtacagcagaggatgacgtcacagcggaagaagctc
ctggaccagttcacaaagcaccagcagggccgcctgaactctcagaggcagaaggcacaa
gagctggaccagctggaagcccagcttgagacccagctgcaggaagctgagcagaccctt
atctcggagctggcgacattggcccgagtgccccttgctgagaacaagccattctccaac
aagcgaggcctgccagagaagccggtaaggaccaaaaggaagaagcccccacctcgggag
agagaggacctggggctaccaaacgatgaccaccctgccttggccgaccactccacagga
ccactcagtgcagtgtactcagcatcgccgcccatccttgtccacagcaacggaaagctg
ggtcagcaggacggcgaagcttgtgatggagaaaacacgaggaagatactgcagaaaaga
agcaatctgtga

DBGET integrated database retrieval system