KEGG   Rattus norvegicus (rat): 291105
Entry
291105            CDS       T01003                                 

Gene name
E2f3, RGD1561600
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04110  Cell cycle
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    291105 (E2f3)
   04218 Cellular senescence
    291105 (E2f3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    291105 (E2f3)
   05206 MicroRNAs in cancer
    291105 (E2f3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    291105 (E2f3)
   05225 Hepatocellular carcinoma
    291105 (E2f3)
   05226 Gastric cancer
    291105 (E2f3)
   05214 Glioma
    291105 (E2f3)
   05220 Chronic myeloid leukemia
    291105 (E2f3)
   05218 Melanoma
    291105 (E2f3)
   05219 Bladder cancer
    291105 (E2f3)
   05215 Prostate cancer
    291105 (E2f3)
   05224 Breast cancer
    291105 (E2f3)
   05222 Small cell lung cancer
    291105 (E2f3)
   05223 Non-small cell lung cancer
    291105 (E2f3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    291105 (E2f3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    291105 (E2f3)
   05161 Hepatitis B
    291105 (E2f3)
   05160 Hepatitis C
    291105 (E2f3)
   05163 Human cytomegalovirus infection
    291105 (E2f3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    291105 (E2f3)
   05169 Epstein-Barr virus infection
    291105 (E2f3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    291105 (E2f3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    291105 (E2f3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    291105 (E2f3)
SSDB
Motif
Pfam: E2F_TDP B-block_TFIIIC
Other DBs
NCBI-GeneID: 291105
NCBI-ProteinID: NP_001131098
RGD: 1561600
Ensembl: ENSRNOG00000029273
UniProt: D4ADR2
LinkDB
Position
17p12
AA seq 245 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASSGFAAAAAPGTYIQILTTN
PSTTSCATSLQSGALAAGPLLPSVPGTEPAASSLLYTTPQGPSSRAGLLQQPPAAGRGGG
GGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLT
KKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWILCYIS
RYSKN
NT seq 738 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agctccggctttgccgccgccgccgccccgggcacgtacatccagatcctcaccacgaac
ccttccaccacgtcctgtgccacctccctccaaagcggcgccctggccgccggccccctt
ctccccagtgtccccggcacggagccggccgccagcagcctcctctacaccacgccacaa
ggaccctccagcagagccgggctgctacagcagccaccagcagcaggacgcggcggcggc
ggtggcccaccggcaaagcgaaggctggagctgggcgagagtggccatcagtacctctca
gatggtctaaaaacccccaagggcaaaggaagagctgcactacggagtcctgatagtcca
aaaactccaaaatctccctcagaaaaaacgcggtatgatacgtcactcggtctgctcacc
aagaagttcattcagctcctgagccagtcacctgatggggtcctggatctgaacaaagca
gcagaggtgctcaaggtgcagaagaggaggatctacgacatcaccaacgtgctggaaggc
atccacctcattaagaagaaatctaagaacaacgtccagtggatcttatgttacatatca
agatattcgaaaaattag

KEGG   Rattus norvegicus (rat): 399489
Entry
399489            CDS       T01003                                 

Gene name
E2f1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04110  Cell cycle
rno04137  Mitophagy - animal
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    399489 (E2f1)
  09143 Cell growth and death
   04110 Cell cycle
    399489 (E2f1)
   04218 Cellular senescence
    399489 (E2f1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    399489 (E2f1)
   05206 MicroRNAs in cancer
    399489 (E2f1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    399489 (E2f1)
   05225 Hepatocellular carcinoma
    399489 (E2f1)
   05226 Gastric cancer
    399489 (E2f1)
   05214 Glioma
    399489 (E2f1)
   05220 Chronic myeloid leukemia
    399489 (E2f1)
   05218 Melanoma
    399489 (E2f1)
   05219 Bladder cancer
    399489 (E2f1)
   05215 Prostate cancer
    399489 (E2f1)
   05224 Breast cancer
    399489 (E2f1)
   05222 Small cell lung cancer
    399489 (E2f1)
   05223 Non-small cell lung cancer
    399489 (E2f1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    399489 (E2f1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    399489 (E2f1)
   05161 Hepatitis B
    399489 (E2f1)
   05160 Hepatitis C
    399489 (E2f1)
   05163 Human cytomegalovirus infection
    399489 (E2f1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    399489 (E2f1)
   05169 Epstein-Barr virus infection
    399489 (E2f1)
   05165 Human papillomavirus infection
    399489 (E2f1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    399489 (E2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    399489 (E2f1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    399489 (E2f1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 399489
NCBI-ProteinID: NP_001094248
RGD: 728892
Ensembl: ENSRNOG00000016708
UniProt: O09139
LinkDB
Position
3q41
AA seq 432 aa
MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQVPTGPAAPPAGPRDPD
VLLFATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSP
GEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAK
KSKNHIQWLGSRTMVGIGQRLEGLTQDLQQLQESEQQLDHLMHICTTQLQLLSEDSDIQR
LAYVTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSAETFQISLKSKQGPIDVFLCPEES
AEGISPGRTSYQETSGEDRNADSGTAGPPPSPPSTSPTLDPSQSLLGLEQEAVLPRIGNL
RAPMEEDRLSPLVAADSLLEHVKEDFSGLLPGEFISLSPPHEAVDYHFGLEEGEGIRDLF
DCDFGDLTPLDF
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggccgtagcccccgcgggcggccagcacgcgccggcgctggaggccctgctcggggcg
ggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccaccgcgcccgatgtc
ggcgccccgcaggtccccaccggccccgccgcgccgcccgctggccctcgagatcctgac
gtgctgctcttcgcaacgccgcaggcgccccgacccgcgcctagtgcaccgcgcccggct
ctcggccgcccgccggtgaaacggaggctggatctggaaactgaccatcagtaccttgct
ggtagcagcgggccattccggggcagaggccgccacccagggaaaggtgtgaaatctcca
ggggagaagtcacgctatgagacctcactaaatctgaccaccaaacgcttcttggagctg
ctgagccactcagctgatggtgttgttgatctgaactgggcagccgaggtgctgaaggtg
cagaaacgacgcatctatgacatcaccaatgtcctggagggcatccaactcattgccaag
aagtccaagaatcatatccagtggctaggcagccgcaccatggtggggatcggtcagcgg
cttgaaggcctgacccaggacctgcaacaactgcaggagagtgagcagcagctggatcac
ctgatgcacatctgtaccactcagctgcaactgctttctgaggactcagacatccagcgc
ctggcctatgtgacctgccaagatctccgcagcattgcagaccctgcagaacaaatggtc
atagtgatcaaggcccctcctgagacccaactacaagctgtggattctgcagagacattt
cagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgccctgaggaaagt
gcagaggggattagccctgggaggacctcataccaggagacatctggggaggacaggaat
gctgactctggcacagcagggcctccaccatcacctccctccacatccccaaccttggat
cccagccagtccctgttaggcctggagcaagaagctgtattgcctcgaataggcaacctg
agggcccccatggaagaagaccggttgtcaccactggtggctgctgactcactcctggag
catgttaaagaagacttctctgggctcctccctggggagttcatcagcctttccccaccc
catgaggctgttgactatcactttggtctcgaggagggtgagggcattagagatctcttt
gactgtgactttggggacttgacccctctggatttctga

KEGG   Rattus norvegicus (rat): 684111
Entry
684111            CDS       T01003                                 

Gene name
E2f2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04110  Cell cycle
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    684111 (E2f2)
   04218 Cellular senescence
    684111 (E2f2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    684111 (E2f2)
   05206 MicroRNAs in cancer
    684111 (E2f2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    684111 (E2f2)
   05225 Hepatocellular carcinoma
    684111 (E2f2)
   05226 Gastric cancer
    684111 (E2f2)
   05214 Glioma
    684111 (E2f2)
   05220 Chronic myeloid leukemia
    684111 (E2f2)
   05218 Melanoma
    684111 (E2f2)
   05219 Bladder cancer
    684111 (E2f2)
   05215 Prostate cancer
    684111 (E2f2)
   05224 Breast cancer
    684111 (E2f2)
   05222 Small cell lung cancer
    684111 (E2f2)
   05223 Non-small cell lung cancer
    684111 (E2f2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    684111 (E2f2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    684111 (E2f2)
   05161 Hepatitis B
    684111 (E2f2)
   05160 Hepatitis C
    684111 (E2f2)
   05163 Human cytomegalovirus infection
    684111 (E2f2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    684111 (E2f2)
   05169 Epstein-Barr virus infection
    684111 (E2f2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    684111 (E2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    684111 (E2f2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    684111 (E2f2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 684111
NCBI-ProteinID: XP_003750109
RGD: 1593939
Ensembl: ENSRNOG00000047741
LinkDB
Position
5q36
AA seq 442 aa
MLRAPRTLAPATAQPTKSLPTLNPTELWPSGLSSPQLCPATTATTYYTSLYTQTVPSSAA
LGTCLDATPHGPEGQIVRCVPAGRLPAKRKLDLEGLGRPTVPEFRTPKGKCIRVDGLPSP
KTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEG
IQLIRKKSKNNIQWVGRGIFEDPTRPAKEQQLGQELKELMNAEQTLDQLIQSCTLSFKHL
TEDNANKKLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRAEENLQIYLKSTQGPI
EVYLCPEEGQEADSPTKEALPSTSTLSPVPDCAQPGCSTDSGLAETIESSVLMPQPVPPP
LPPPPPAPSLVPLEATDNMLELSHPLLQQTEDQFLSPILTASSPLISFSPPLDQEEYLWG
MDEGEGISDLFDSYDLGDLLIN
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgctgcgcgcgccgcggaccctggctccggccacggcgcaacccacaaagagcttgccg
acgttgaaccccaccgagctgtggccttcgggtctgagcagtccccagctctgcccggcc
accaccgccactacctactacacttcgctttacacgcagacggtgccttcctctgcggcg
ctgggcacctgcctcgacgccactccccacggacccgagggccaaattgtgcgatgtgta
cccgcaggccgcctgccggccaaaaggaagctagacctggagggccttgggaggcctacg
gtcccagaattccggactcccaaggggaagtgcatccgagtggatggtttgccaagcccg
aaaacccctaagtctcctggggagaagacacgctatgacacgtcgctggggctgctgacc
aagaagttcatttacctcctgagcgagtcggaggatggagtcctggacctgaactgggca
gctgaggtgctggatgtgcagaagcggcgcatatatgacatcaccaacgtgctggagggc
atccagctcatccgcaagaagtccaaaaacaacatccagtgggtaggcaggggaatattt
gaagaccccacccgaccggccaaggagcagcagctggggcaggaactgaaggagctaatg
aatgcggagcagaccttggaccagctcattcagagctgcacgctgagcttcaagcacctg
acagaagataatgccaacaagaaactggcctatgtgacctaccaggatatccgtgctgtg
ggcaacttcaaggagcagacagtgattgcggtcaaggccccgccacagacaagattggaa
gtgccggacagggcggaggagaacctgcagatttacctaaagagtacccaaggccccatt
gaagtctacctgtgcccggaggaggggcaggaggcagacagtcctaccaaggaggcccta
ccctccacctctaccctcagccctgtccctgactgcgctcagcccggctgcagcaccgac
tctgggctggcagagaccatagagtcttcagtactgatgccacagccggtaccgccaccg
ctgccgccgccgccgccagcaccatcccttgtccccttggaagccactgacaacatgctg
gagctgtcacacccacttctgcaacagactgaggaccagttcctgtccccaatcctgaca
gccagctcccctctgatcagcttctccccgcccttggaccaggaggagtacctgtggggc
atggatgagggggagggcatcagtgacctcttcgactcctatgaccttggggacctgctg
attaattga

DBGET integrated database retrieval system