KEGG   Rattus norvegicus (rat): 291936
Entry
291936            CDS       T01003                                 

Gene name
Hhip, RGD1564108
Definition
(RefSeq) Hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04340  Hedgehog signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    291936 (Hhip)
   04024 cAMP signaling pathway
    291936 (Hhip)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    291936 (Hhip)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    291936 (Hhip)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 291936
NCBI-ProteinID: NP_001178746
RGD: 1564108
Ensembl: ENSRNOG00000018268
UniProt: D3ZGL3
LinkDB
Position
19q11
AA seq 700 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGSPPKRLKRRDRRMMSQLE
LLSGGEILCGGFYPRVSCCLQSDSPGLGRLENKIFSATNNTECGRLLEEIKCAPCSPHSQ
SLFFSPERDVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYARKDAGLCF
PDFPRKQVRGPASNYLDQMEDYEKVEEISRKHKHNCFCVQEVMSGLRQPVGAVHSGDGSL
RLFILEKEGYVKILTPEGEMLKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDVRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDADTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGRDYESEQSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGAS
GSCQGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIIDPKRPLMPEECRVTVQP
AQTLTSDISRLCRNGYYTPTGKCCCSPGWEGDFCRIAKCEPPCRHGGVCVRPNKCLCKKG
YLGPQCERADRSMRRVTRAGILDQIIDVTSYLLDLTSYIV
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgctgaagatgctctcgtttaagctgctactgctggccgtggctctgggcttctttgaa
ggagatgccaagtttggggaaaggagcgaagggagcggagcgaggaggagaaggtgcctg
aatgggagccccccaaagcgcctgaaaagaagggacaggaggatgatgtcccagctggag
ctgctgagtggaggagagattctgtgtggtggcttctacccaagagtatcctgctgcctg
cagagtgacagccctggattggggcgtctggagaacaagatcttttctgccaccaacaac
acagaatgtgggaggctcctggaggagatcaaatgtgctccttgctctccccactcccag
agcctgttcttctcacctgaaagagatgtcctggatggagaccttgcacttccactcctc
tgcaaggactactgcaaagaattcttttacacttgtcggggccatattccaggtcttctt
caaacaactgctgatgaattttgcttttactatgcaagaaaagatgctgggttatgcttt
ccagacttcccgagaaagcaagtcagaggaccagcatctaactatttggaccagatggaa
gactatgagaaagtcgaagagatcagcagaaagcacaaacacaactgcttctgtgtccag
gaggtcatgagtgggctgcggcagcctgtgggtgctgtgcacagtggggatggctccctt
cgactcttcatcctagagaaggaaggctacgtgaagattctaaccccagaaggagaaatg
ctcaaggagccttacttggacattcacaaacttgttcagagtggaataaagggaggagac
gagaggggcctgctaagcctggcattccaccccaattacaagaaaaacgggaagctctac
gtgtcttacaccaccaaccaggaacggtgggctattgggcctcacgaccacatccttagg
gttgtggaatacacagtatccaggaaaaatccccatcaagttgatgtaagaacagccagg
gtgtttctggaagttgcagagctccaccggaagcatcttgggggacagctgctctttggt
cctgatggctttttgtacatcatcctcggggatgggatgatcacactggatgacatggag
gagatggatgggttaagtgatttcacaggctctgtgctgaggctggatgcggacaccgac
atgtgcaatgtgccttactccattcctcggagtaacccccacttcaacagcaccaaccag
cctccagaagtatttgcccatggcctccatgatccaggcagatgtgccgtggatcgacat
cccactgatataaacatcaatttaacaatactttgctcagattccaatgggaagaacaga
tcgtcggccagaattctacagataataaaaggaagagattacgaaagcgagcaatctctt
ctagaattcaagccattcagtaacggccctttggttggtggattcgtttacagaggctgc
cagtctgaaagattgtacggaagctacgtgttcggagatcgcaatgggaatttcttaacc
ctccagcaaagcccagtgactaagcaatggcaagaaaagccactctgtctgggtgccagc
ggctcctgtcaaggctacttttcgggtcacatcttgggatttggagaagatgaattagga
gaggtttacattctatcaagcagtaagagtatgacccagactcacaatggaaaactctac
aagatcatagacccaaaaagacctttgatgcctgaggaatgcagagtcacagttcaacct
gcccagacactgacctcagatatttcccggctctgtcggaacggctactacacccccacg
ggcaagtgctgctgcagtcctggctgggagggagacttctgcagaattgccaaatgtgag
ccaccttgtcgtcacggaggtgtctgtgtcagaccaaacaagtgcctctgtaaaaagggc
tatctcggccctcagtgtgaacgagcggacaggagcatgcgcagagtgaccagggcaggt
attcttgaccagatcattgacgtgacgtcttacttgctggatctcacaagttacatcgta
tag

DBGET integrated database retrieval system