KEGG   Rattus norvegicus (rat): 294521
Entry
294521            CDS       T01003                                 

Gene name
Ak9
Definition
(RefSeq) adenylate kinase 9 isoform X1
  KO
K18533  adenylate/nucleoside-diphosphate kinase [EC:2.7.4.3 2.7.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    294521 (Ak9)
   00240 Pyrimidine metabolism
    294521 (Ak9)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     294521 (Ak9)
    2.7.4.6  nucleoside-diphosphate kinase
     294521 (Ak9)
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA YHS AAA_33 AAA_28 AAA_22 AAA_24 AAA_16 RNA_helicase FAP206 NACHT Cytidylate_kin AAA_5 AAA_14 RuvB_N Zeta_toxin MMR_HSR1 NTPase_1 NB-ARC ABC_tran KTI12 TsaE CobU AAA_19 AAA_30 ATPase_2 Thymidylate_kin ZZ G-alpha Hydin_ADK DnaB_C
Other DBs
NCBI-GeneID: 294521
NCBI-ProteinID: XP_008771242
RGD: 1559879
Ensembl: ENSRNOG00000037688
UniProt: F1M632
LinkDB
Position
20
AA seq 1889 aa
MASEEKTEEHPFADIFNEDETDRNCLLSKPACFIIFGKPGVGKTTLARSIAQAWKCIRVE
AISVLEEHIAAENETGTMLQSLLVSGHTVPDELVTKLVLEKIKSPEVSHFGYILTEIPSL
SQDNMTSLKQIEIIKHLELQPDVIINIKCSDYDLCQRISGQRQHSTTGYIYTREQWDPEI
IESRRKKKKEVLKEGKAEEEEEEEQEEEEEAFLAEMQMVTETLQYLVQRPEDYLENIEVT
VNLYKELLLNALEEVMAEHNPQYLIELDGNKPPEELFLTVIERLKYLNVRRAAIITKLQG
TEEEMTDIIDTEELFRTVSSYKLMGPRYRWNRSKWARACPVSLKDGNIYPGAADFSVSFL
GKMYCLSSEETLKLFLLNPRPFLLPPMPLPPCKVFIFGPNHSGKTTLANLIAEHFKAKVI
DYATLVQPRFDSAREKLIKDTISEATNTAIKLVKERLLNDLRVKKQEEKTLKELRMHYTK
KEYEDFSDYKKTKSSEEFPSSADDPEAQGSRNLSALEIGPEDKSRSENTISGDTDKDGSP
EELIEEVTENHPEVFAMIEDTLRHSKELNFEQPYDKQAEILEEVIKEVTKDNKNRFAGAP
KYGGWIVKNFPIMRELWMSLIEKALLPDLVVNLSDTESNGKIVLTRLYLSNKAEINAKIL
ERLKEELQVKKREEDEIRKVKEEELRLEEEKQRMMELEAKKAKVVEEPDNEAEEEVDVEE
SEIHEETEAQEMGELARESSIPGGSESSEVPEAEHDPEAEFKAPEDTAVEAETEKGSKET
LELEEQLKAMLPEFPEDGYPNVPEMEPLKEVLANYLIAWKQLEPIISDSLVPVLTVDISN
KTPKELLQRVIEMMEKPFKYGAWELNAEDYEEEAEDYQAEMEVEEEQEEEEEEEEEGEEK
SKERRRHLGDTKHFCPVVLKENFVLQPGSTEEAVKYREKIYYFSTPEAKEKFLEHPEDYV
SQNEPLKAPPLRICLLGPHGSGKTVCARKLAENFGIFHIQFEEFLQERMLLKAERKFGPE
FEDDSEEEQAMKQELEELAAQANVKIEEDNTKKQLPEVQFTEEEEAIKLSLTDNEPLPSE
ILDPMLSEWWLKEPIRSTGFILDGFPRYPEEAQFLGERGFFPDAAVIIQVDDQDIFDRLL
PAQVQKWKTKQLKKSERKKMIKEMKAKIKEDMVAKRRAELISEREKRKKGEGAFRDEEEF
SDEDAEDEDDIENILEEEFPKDEEEMSEEDEEQEGDATERLRSELGEKFETETNNIQSIQ
DEFERFLIPIIPVNGARKMHIVQYVLNVKLKPLVENRASIFEKCYPVSPHLAHKMLAFTY
KHMSSFGYWDPVKLSEGETIKPVETAENPLNPIIHRHYIYFLSTKQTKEKFMMNPIKYIR
QPKPKASMPVRIMIVGPPKSGKSTVAKQLANDYGLKCLSMGDALRGMLSNHPEAELSLRI
NWHLHKGMTVPDDLAIQALDISLLDSVCNTVGVVIDGYPVTPHQVELLEARSIIPMIIFE
LDVPSKEIFKRLLLEKKSEQGMPYPMHNSTQIIAYRNAKYRKNVNEIRQFYQRQHQNWHV
IDGFHSKWWVWNEVIKDIQQMNKYIQTYMEKIKEGKAACIDKLCITPEELISRLGEFKQF
CPVSLAESNELIDCSVTSSLEFTAEFRGHYYKMSSQEKLNKFLKNPELYVPPLAPHPLPP
DDMLPKRLTLSELKSRFPMSAELQGYCPVTYKDGKQRYEALVPGDNEYAVEYRGRIYICE
SEEKLQKFLRLPMKYWDQKLPHKLPPPKESIHLTSLPLPGYLEQGTATSLIKAMNAAGNL
KPKLPFLSVRRSVLLYIAFHLKAFNPKGSEYSRKKYKKKMEQFVERCELITYLSSKMTRK
FKEPQFRPIDFDHKLQTFMSLKNIDPVTG
NT seq 5670 nt   +upstreamnt  +downstreamnt
atggcttctgaagaaaagacagaagaacatccattcgcagacatctttaacgaagatgaa
acggacaggaactgtctgctgtccaaaccagcctgctttattatatttgggaaacctggg
gttgggaagacaacgttagcccggagcatagcacaggcatggaaatgtattcgtgttgaa
gctatatcggttttggaagagcacattgcggctgagaatgaaaccggaactatgctgcag
tcactgctggtaagcggtcacaccgtcccagacgagctggtcacaaagttggtcctggag
aagatcaagtctccagaagtttctcactttggctacatcctcactgaaattccgtcactc
tcacaggataacatgacctctttgaagcaaatagaaattattaaacatttagaattgcag
cccgatgtcataatcaatattaagtgcagtgactacgatttatgccaaagaatttctggg
caacgacagcacagtactacaggctacatatacaccagagaacagtgggacccagaaatt
attgagagccgcaggaaaaagaagaaggaagtcctcaaggaaggaaaagccgaagaggag
gaagaggaagaacaagaagaagaggaggaggcgtttctggctgaaatgcagatggtgacc
gaaactcttcaataccttgtccagaggcctgaagattatctggagaacattgaagtcacc
gtgaacctttacaaggagcttctcctcaatgctttagaggaggtaatggctgagcataac
ccgcagtatctcatcgagctggatgggaataagccaccggaggagctcttcctgacggtc
atagagcggctgaagtacttgaacgtgcggcgggcagccatcataaccaagcttcagggc
acagaagaggagatgacggacataattgacactgaagagctgttccgcacagtgtcgtct
tataaactcatggggccaaggtatagatggaaccgaagcaagtgggcgcgggcttgcccg
gtgtccttaaaggatgggaacatttatccaggagcagcagacttttccgtgagttttcta
ggtaaaatgtactgcctttcttcggaagaaacattaaaattgttcttgctgaacccccgt
cccttcctcctaccacctatgccgttgccaccttgcaaagtctttatctttggacccaac
cactcagggaaaaccacactggccaacctgattgcagaacacttcaaagcaaaggtaatt
gactatgccacgcttgttcagccacgttttgacagtgcccgtgaaaagctaattaaagac
accataagcgaggccaccaacacggccatcaaactcgtgaaagagaggctcctgaatgac
ttgcgagtcaaaaagcaagaggagaagaccttgaaggaactgcgaatgcactatacaaaa
aaagagtacgaagacttctcggattataaaaagacaaaaagttctgaagagtttccatcc
tctgcagacgacccagaagctcaaggctccaggaacttaagcgccttagagattggcccg
gaagacaagtcaaggtcagagaacaccatttccggggacactgataaagatggctcccca
gaagagttgatagaagaggtgactgagaatcacccagaggtgtttgccatgatcgaggat
actctgagacattccaaggagttgaactttgagcagccatatgacaaacaggctgaaata
ctggaggaagtcatcaaagaggtaacgaaagataacaagaataggttcgctggtgccccg
aagtacggaggatggattgtgaagaacttccccataatgcgggaactgtggatgtccttg
atagaaaaagcacttttacctgatctggttgtcaatctatcagatacagaaagcaacgga
aaaatcgtgttaactagattatatttaagcaataaggcagagatcaatgctaagatttta
gaaagactgaaagaagaattgcaagtcaaaaagagagaggaggacgaaatacgaaaagtc
aaagaggaggaactgaggctggaagaagaaaaacaaaggatgatggagcttgaggctaag
aaagcaaaagttgttgaagagcccgataacgaagctgaggaggaggtggatgtggaagag
tctgagatccatgaagagacggaggcacaagaaatgggtgaactcgccagagagtcatct
atacctggggggtctgagtcatccgaggtcccagaagcagagcatgacccggaagcagaa
ttcaaggctcctgaggacactgcagtcgaagcagaaactgaaaagggatctaaagagacc
ctggagttggaagagcagctgaaagccatgctgccagagtttccggaagatggctacccc
aacgtccctgaaatggagccactgaaggaagtgttggccaactacttgatcgcatggaaa
cagctggagcccataatttctgacagcctggtgccggtattaacagtggatatttccaac
aaaacacccaaggagctgcttcagcgcgtgattgagatgatggaaaagccttttaagtat
ggtgcttgggaactaaacgcggaagactatgaagaagaagcagaagactatcaggctgaa
atggaagtcgaggaggagcaggaggaagaggaagaggaagaggaagagggtgaagaaaaa
agtaaagaaaggaggagacacttgggagataccaaacacttctgcccggtggttctcaaa
gaaaactttgttctacaaccgggcagcacggaagaggccgttaaataccgggagaagata
tactacttctcaacccctgaggcaaaggagaagttcctggagcatcctgaggactacgtg
tcccagaacgaacccttaaaggctccaccgctaaggatttgtcttctgggtcctcatggt
tctggcaaaactgtgtgcgcgagaaagctggcagaaaattttggcattttccacattcaa
ttcgaggaatttctccaagaaagaatgctgctcaaagctgaacggaaattcggacctgaa
tttgaggacgattctgaggaggagcaagcgatgaagcaagagcttgaagagcttgcagct
caggcaaatgtgaagatcgaagaagacaatacaaagaagcagcttccagaagtgcaattc
acagaggaagaagaggcgatcaagctgagtctgacggacaacgagcccctgccttcggaa
attctagaccccatgctctctgagtggtggcttaaagaaccaatacgctccacgggcttt
atcctggacggcttcccgcggtaccctgaggaggcccagtttctgggagagcggggattt
ttcccagacgccgcagttataatacaagtcgatgatcaagacatcttcgatcgcctcctc
cccgcccaagttcagaaatggaagacgaaacaactcaagaaatcagagaggaaaaaaatg
atcaaagaaatgaaggcgaaaatcaaggaagatatggtcgctaaaagaagagctgaactt
atttcagagcgagagaaaagaaagaaaggggagggcgcttttagagatgaggaggagttt
agtgacgaagatgccgaagacgaggacgatattgagaacatccttgaggaagagtttcca
aaggatgaggaggagatgagcgaggaagacgaggaacaggaaggagatgccaccgagcgc
ctgagaagcgagctgggggagaaatttgaaacagaaacaaataatatccaatcgatacag
gatgagttcgaaaggtttctgataccaataattccggtcaacggagcaaggaaaatgcat
attgtacaatacgtactgaatgtgaaactgaagcccctggtggaaaaccgtgcgagcatt
tttgaaaagtgttacccggtatccccgcacctcgctcataaaatgcttgccttcacctac
aaacacatgagctcgtttggctactgggaccctgtaaagctaagtgagggagagaccatc
aaacctgttgaaacggcagagaacccgctgaaccctataattcatcgtcactacatctat
ttcttatccaccaaacaaactaaagagaaatttatgatgaacccaatcaaatacatccgg
cagcccaaacccaaagcttccatgcctgtgaggatcatgattgtggggccgcccaagtcg
gggaaaagtacagttgccaaacagctggcaaatgactacggcttaaaatgtttgtcgatg
ggagacgcgttgcgtggaatgttaagcaatcacccagaggcagagctgtcgctgaggata
aactggcatcttcacaaagggatgacggtgcctgacgacctggctattcaagctttagac
atctctctgttggacagtgtgtgcaacactgtaggtgtggtcatcgatggctaccccgtc
accccacaccaggtggaactcttggaggcaaggtcaatcattcccatgatcatctttgag
ttggatgtgccgtctaaggagattttcaaaagactgctcttagagaagaagagtgaacaa
ggtatgccttatccgatgcacaacagcacgcagatcatagcctataggaacgcaaagtac
cgtaaaaatgtcaatgagatcaggcagttttatcaacggcagcatcaaaactggcatgtg
attgacgggttccacagtaaatggtgggtatggaatgaagtcatcaaagacatccagcag
atgaacaagtacatacagacatacatggagaaaataaaggaagggaaagccgcgtgcatt
gacaagctatgcatcacacctgaggagctgatttctcgcctgggagagtttaaacagttc
tgccctgtcagcctagcagagtccaatgaactaattgactgctccgtaactagcagcttg
gaattcacagcagagttcaggggacactattataaaatgagttcccaggaaaagctaaac
aaatttctgaagaacccagaactgtatgtgcctcccttggcacctcatccgctcccacca
gatgacatgcttcccaagaggctgacactgtcggagctgaagagtcgttttcctatgtcg
gctgagcttcagggttactgcccagtgacttacaaggatgggaaacaaagatatgaagcc
ctggtgcctggtgacaacgaatatgctgtagagtatcgcggacgcatatacatctgtgag
agcgaagaaaaactccagaaattcctgaggttgccaatgaaatactgggaccagaagctt
ccgcacaaacttcccccgcccaaggaatccatccacctcaccagcctgcctttgcctggg
tacctggaacagggcacagcaacatccctgatcaaggcaatgaatgcagccgggaacctg
aaacccaagctccccttcctaagtgtgaggaggtctgtgctcctttacatagcgttccat
ctcaaagcatttaaccccaagggttctgaatattcgagaaaaaaatataaaaagaagatg
gagcagttcgtggaaaggtgtgaactcatcacgtacctcagctccaagatgacccggaag
ttcaaggagcctcagttcagacccatcgacttcgatcataagctacagacgtttatgtcc
ttgaaaaacatagacccagttactgggtag

DBGET integrated database retrieval system