KEGG   Rattus norvegicus (rat): 29499
Entry
29499             CDS       T01003                                 

Gene name
Shh
Definition
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno04360  Axon guidance
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    29499 (Shh)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    29499 (Shh)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29499 (Shh)
   05205 Proteoglycans in cancer
    29499 (Shh)
  09162 Cancer: specific types
   05226 Gastric cancer
    29499 (Shh)
   05217 Basal cell carcinoma
    29499 (Shh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29499 (Shh)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29499 (Shh)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C46: hedgehog family
   29499 (Shh)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   29499 (Shh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 29499
NCBI-ProteinID: NP_058917
RGD: 3673
Ensembl: ENSRNOG00000006120
UniProt: Q63673
LinkDB
Position
4q11
AA seq 437 aa
MLLLLARCFLVALASSLLVCPGLACGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKA
RIHCSVKAENSVAAKSDGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFL
TFLDRDEGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSGPTPGPSPLFASRVRPGQR
VYVVAERGGDRRLLPAAVHSVTLREEAAGAYAPLTADGTILINRVLASCYAVIEEHSWAH
RAFAPFRLAHALLAALAPARTDGGGGGSIPAPQSVAEARGAGPPAGIHWYSQLLYHIGTW
LLDSETLHPLGMAVKSS
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgctgctgctggccagatgttttctggtggcccttgcttcctcgctgctggtgtgc
cccggactggcctgtgggcccggcagggggtttggaaagaggcagcaccccaaaaagctg
acccctttagcctacaagcagtttatccccaacgtagccgagaagaccctaggggccagc
ggccgatatgaagggaagatcacaagaaactccgaacgatttaaggaactcacccccaat
tacaaccccgacatcatatttaaggatgaggaaaacactggagcagaccggctgatgact
cagaggtgcaaagacaagttaaatgccttggccatctccgtgatgaaccagtggcctgga
gtgaagcttcgagtgactgagggctgggatgaggacggccatcattcagaggagtctcta
cactatgagggtcgagcagtggacatcaccacgtctgacagggaccgcagcaagtatggc
atgctggctcgcctggctgtggaggctggattcgactgggtctactatgaatccaaagct
cgcatccactgctctgtgaaagcagagaactccgtggcggccaaatctgacggctgcttc
ccgggatcagccacagtgcacctggagcagggtggcaccaagttagtgaaggatctaagt
cccggggaccgcgtgctggcggctgacgaccagggccggctgctgtacagcgacttcctc
accttcctggaccgcgacgaaggtgccaagaaggtcttctacgtgatcgagacgcgggag
ccgcgggagcgtctgctgctcactgccgcgcacctgctcttcgtggcgccgcacaacgac
tccgggcccactccgggaccgagcccactcttcgccagccgcgtgcgtccggggcagcgc
gtgtacgtggtggctgaacgcggcggggaccgccggctgctgcccgccgcggtgcacagc
gtaacgctacgagaggaggcggcgggtgcgtacgcgccgctcacggcggacggcaccatt
ctcatcaaccgggtgctcgcctcgtgctacgcagtcatcgaggagcacagctgggcacac
cgggccttcgcgcccttccgcctggcgcacgcgctgctggccgcgctggcacccgcccgc
acggacggcgggggcgggggcagcatccctgccccgcaatctgtagcggaagcgaggggc
gcagggccgcctgcgggcatccactggtactcgcagctgctgtaccacattggcacctgg
ctgttggacagcgagaccctgcatcccttgggaatggcagtcaagtccagctga

KEGG   Rattus norvegicus (rat): 84380
Entry
84380             CDS       T01003                                 

Gene name
Dhh
Definition
(RefSeq) desert hedgehog
  KO
K11990  desert hedgehog
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    84380 (Dhh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    84380 (Dhh)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C46: hedgehog family
   84380 (Dhh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 84380
NCBI-ProteinID: NP_445819
RGD: 620711
Ensembl: ENSRNOG00000053675
UniProt: G3V7Y0
LinkDB
Position
7q36
AA seq 396 aa
MALPASLLPLCCLALLALSVQSCGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGAS
GPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HIHVSVKADNSLAVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTPVL
LFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELMG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctctgccagccagtctgttgcccctgtgctgcttggcactcctggcactatctgtc
cagagctgcgggccaggccgaggaccggttggccggcggcgttacgtgcgcaagcaactt
gtgcctctgctctacaagcagtttgtgcctagtatgcccgagcggacccttggcgcgagt
gggccagcggaggggagggtaacaagggggtcggagcgcttccgggacctcgtccccaac
tacaaccccgacataatcttcaaggatgaggagaacagcggcgctgaccgcctgatgaca
gagcgttgcaaagagcgggtgaatgctctagccatcgcggtgatgaacatgtggcccgga
gtacgcctacgcgtgactgaaggttgggacgaggatggccaccacgcacaggactcactg
cactacgaaggccgtgccctggacatcaccacgtctgaccgtgaccgtaataagtatggt
ttgttggcgcgcctagcagtggaagccggattcgactgggtctactacgagtcccgcaac
cacatccacgtgtcggtcaaagctgataactcattggcggtccgagccggaggctgcttt
ccgggaaatgccacggtgcgcttgcggagcggcgaacggaaggggctgagggaactccat
cgtggtgactgggtactggccgctgatgcagcgggccgagtggtacccacgccggtgctg
ctcttcctggaccgggacctgcagcgccgcgcctcgttcgtggctgtggagaccgagcgg
ccaccgcgcaaactgttgctcacaccctggcatctggtgttcgccgctcgggggccagcg
cctgctccaggtgactttgcaccggtgttcgcgcgccgcttacgcgctggggactcggta
ctggctcccggcggggacgcgctccggcctgcgcgcgtagcccgcgtggcgcgcgaggaa
gccgtgggcgtgttcgcaccgctcacggctcacgggacgctgctggtcaacgacgtcctc
gcctcctgctacgcggttctagagagtcaccagtgggcccaccgcgcctttgctcctttg
cgtttgctgcacgcgctcggggcgctgctccccgggggtgcagtccagccgactggcatg
cattggtactcgcgcctcctttaccgcttggcggaggagttaatgggttga

KEGG   Rattus norvegicus (rat): 84399
Entry
84399             CDS       T01003                                 

Gene name
Ihh
Definition
(RefSeq) Indian hedgehog
  KO
K11989  indian hedgehog
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    84399 (Ihh)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    84399 (Ihh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    84399 (Ihh)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C46: hedgehog family
   84399 (Ihh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 84399
NCBI-ProteinID: NP_445836
RGD: 620021
Ensembl: ENSRNOG00000018059
UniProt: F1LP42
LinkDB
Position
9q33
AA seq 411 aa
MSPAWLRPRLRFCLLLLLLLLVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVHLETGERVALSAVKPGDRVLAMGEDGNPTF
SDVLIFLDREPNRLRAFQVIETQDPPRRLALTPAHLLFIADNHTEPAARFRATFASHVQP
GQYVLVAGVPGLQPARVAAISTHVALGSYAPLTRHGTLVVEDVVASCFAAVSDHHLAQLA
FWPLRLFPSLPWGSWTPSEGVHWYPQLLYRLGRLLLEESTFHPLGMSGAGS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtctcccgcctggctccggccccgactgcgcttctgtctgctcctgctgctgctgctt
ctggtgccggcggcgcggggctgcgggccgggccgggtggtgggcagccgccggaggccg
cctcgtaaactcgtgcctcttgcctacaagcagttcagccccaacgtgccggagaagacc
ctgggcgccagcgggcgctacgaaggcaagatcgcgcgcagctctgagcgcttcaaggag
ctcacccccaactacaatcccgacatcatcttcaaagacgaggagaacaccggtgccgac
cgcctcatgacccagcgctgcaaggaccgtctgaactcactggccatctctgtcatgaac
cagtggccgggtgtgaagctgcgggtgacggaaggctgggatgaagacggccatcactca
gaggaatctttacactatgagggccgcgcggtggatatcaccacctcagaccgcgaccga
aataagtacggactactggcgcgcttagcagtggaggccggcttcgactgggtgtattac
gagtccaaggcccacgttcattgctctgtcaagtctgagcactcggctgctgccaagaca
ggtggctgctttcctgccggagcccaggtccacctagaaactggggagcgtgtggccctg
tcagctgtgaagccaggagaccgggtcctggccatgggggaagatggcaaccccaccttc
agcgatgtgctcattttcctggaccgtgagccaaacaggctgagagctttccaggtcatc
gagactcaggatcctccacgtcggctggcactcacgcctgcccacctgctcttcattgcg
gacaatcatacagaaccagcagcccgcttccgggccacgtttgccagccacgtgcagcca
ggccaatatgtgctggtagcaggggtcccaggcctccagcctgctcgggtggcagccatc
tccacccacgtggcccttgggtcctatgctcctctcacgaggcacgggacactcgtggtg
gaggatgtggtagcctcctgcttcgcagctgtgtctgaccaccatctggctcagttggcc
ttctggcccctgcgactgtttcccagcttgccatggggcagctggaccccaagtgaaggt
gttcactggtaccctcagctgctctaccgcctggggcgtctcttgctagaagagagcacc
ttccatccactgggcatgtctggggcaggaagctga

DBGET integrated database retrieval system