KEGG   Rattus norvegicus (rat): 295037Help
Entry
295037            CDS       T01003                                 

Gene name
Mgst2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    295037 (Mgst2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    295037 (Mgst2)
   00982 Drug metabolism - cytochrome P450
    295037 (Mgst2)
   00983 Drug metabolism - other enzymes
    295037 (Mgst2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    295037 (Mgst2)
   05204 Chemical carcinogenesis
    295037 (Mgst2)
   05225 Hepatocellular carcinoma
    295037 (Mgst2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    295037 (Mgst2)
  Drug resistance
   01524 Platinum drug resistance
    295037 (Mgst2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     295037 (Mgst2)
Transporters [BR:rno02000]
 Other Transporters
  Pores ion channels [TC:1]
   295037 (Mgst2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 295037
NCBI-ProteinID: NP_001099900
RGD: 1311218
Ensembl: ENSRNOG00000061857
LinkDB All DBs
Position
2q26
AA seq 147 aa AA seqDB search
MAGDSSLLAAVSLLSACQQSYFALQVGRVRLKYKIAPPAVTGSLEFERIFRAQQNSLEFY
SVFIISLWMAGWYFNQVFATCLGLLYIYARHKYFWGYAEAAEKRIIGFRLSLGILALLTV
LAVLGVASRFLDEYLDFHVAKKLKRPF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggattcaagcctgctggctgcagtctcccttctctctgcctgtcagcaaagt
tattttgctttgcaagtcggacgagtaagattaaaatacaagatcgcacctccagcagtc
acgggctctctggagtttgagagaatatttcgcgcacagcaaaactctttggagttttat
tccgtattcatcatatcgctgtggatggctggatggtatttcaatcaagtttttgcaacc
tgtctgggtctcctgtacatatacgcccgtcacaagtatttctggggctatgcagaagcc
gctgaaaaaaggatcattggtttccggctgagcctgggcattttggccttgctgactgtc
ctcgctgtcctgggggtagcaagcagattcctggacgaatacctggactttcatgttgcc
aagaaactgaagcggcccttctaa

DBGET integrated database retrieval system