KEGG   Rattus norvegicus (rat): 295088
Entry
295088            CDS       T01003                                 

Gene name
Gmps
Definition
(RefSeq) GMP synthase [glutamine-hydrolyzing]
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Module
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    295088 (Gmps)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    295088 (Gmps)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    295088 (Gmps)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     295088 (Gmps)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   295088 (Gmps)
SSDB
Motif
Pfam: GATase GMP_synt_C Peptidase_C26 NAD_synthase QueC tRNA_Me_trans ATP_bind_3 Asn_synthase PAPS_reduct ThiI Arginosuc_synth Pyr_redox_2
Other DBs
NCBI-GeneID: 295088
NCBI-ProteinID: NP_001019925
RGD: 1310063
Ensembl: ENSRNOG00000051151
UniProt: Q4V7C6
LinkDB
Position
2
AA seq 693 aa
MALCNGDSKPENAGGDLKDGCHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETP
AFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHK
KSVREDGVFNISMDNTCSLFRGLQKEEIVLLTHGDSVDKVADGFKVVARSGNIVAGIANE
SKKLYGVQFHPEVGLTENGKVILKNFLYDIAGCSGNFTVQNRELECIREIKEKVGTSKVL
VLLSGGVDSTVCTALLNRALNQDQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
HSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMSLKPE
EVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVR
ILGRELDLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPH
TLLQRVKACTTEEDQEKLMEITSQHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDW
ESLIFLARLIPRMCHNINRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILR
ESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGVPATPGNEIPVE
VVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggccctgtgcaacggagattccaagccggagaatgctggaggagaccttaaggatggt
tgtcaccactacgaaggagctgttgtcattctggatgctggggctcagtatggaaaagtc
attgaccgaagagtgcgggagctctttgtacagtctgaaatctttcctttggaaacacca
gcttttgccataaaggaacaaggatttcgggctattatcatatctggaggacctaattct
gtgtatgcagaggatgctccctggtttgatccagcaatatttaccattggcaagcctgtc
ctaggaatttgctatggaatgcagatgatgaataaggtttttggaggcactgtgcataaa
aaaagtgttagagaggatggcgttttcaacattagtatggacaatacatgttcattgttc
aggggcctgcagaaggaagaaattgttttacttacacatggagacagtgtagacaaagta
gctgatggattcaaggttgtagctcgttctgggaacattgttgcaggtatagccaatgaa
tctaagaagctatatggtgtacagttccaccctgaagttggccttacagaaaatggaaaa
gtaatactgaagaatttcctatatgatatagctggatgcagtgggaactttactgtgcag
aaccgagaacttgagtgcattcgagagattaaagagaaagtaggaacgtcaaaagtgttg
gttttactcagtggtggtgtagattcaactgtttgtactgctttgctaaatcgtgctttg
aaccaagatcaagtcattgctgtacacattgataatggctttatgagaaaacgagaaagc
cagtctgttgaagaggccctcaaaaagcttggaattcaggtcaaagtgataaatgctgct
cattccttctataatggaacaactactctgccaatatcagatgaagacaggaccccacgg
aaaagaattagcaaaacattaaatatgacaacaagtcctgaggagaaaagaaaaattatt
ggtgatacttttgttaagattgccaatgaagtcattggagaaatgagtctgaagccagag
gaggtttttcttgcccaaggcactttacggcctgatctaatcgaaagtgcatcccttgtt
gcaagcggcaaagctgaactcatcaaaacccaccacaacgacacagagcttatcaggaag
ttaagggaagaggggaaagtaatagaacctctgaaagattttcataaagatgaagttagg
attttaggcagagagcttgacctgccagaagaattggtttccaggcatccttttccaggt
cctggcctggcaatcagagtaatatgtgctgaagaaccttatatttgtaaagactttcct
gaaaccaacaatattttgaaaatagtagctgatttttctgcaagtgttaagaagcctcat
acactgttacaaagagtcaaagcttgcacaacagaagaggaccaggagaaactcatggaa
attacaagtcagcattcattgaatgctttcttgctgccaattaagactgtgggtgtgcag
ggtgactgtcgttcttatagttatgtgtgtggaatctccagtaaagatgaacctgactgg
gaatctcttattttccttgccagacttatacctcgaatgtgtcataacattaacagagtt
gtctatatctttggcccaccagttaaagaacctcctacagatgttactccaacatttttg
acaacaggggtgctcagtactttacgccaagctgattttgaggcccataacattctccgg
gagtctgggtatgctgggaaaatcagccagatgccagtgattttgaccccattacatttc
gatcgagatccacttcagaagcagccttcatgccagaggtctgtggttattcgaaccttt
attactagtgacttcatgactggagtacctgcaacacctggcaatgaaattcctgtagag
gtggtgctaaagatggtcactgagataaagaagattcctggaatttctagaattatgtat
gacctaacgtcaaagcccccgggaaccactgagtgggagtaa

DBGET integrated database retrieval system