KEGG   Rattus norvegicus (rat): 29527Help
Entry
29527             CDS       T01003                                 

Gene name
Ptgs2, COX-2, Cox2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04064  NF-kappa B signaling pathway
rno04370  VEGF signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04726  Serotonergic synapse
rno04913  Ovarian steroidogenesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno05140  Leishmaniasis
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05206  MicroRNAs in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    29527 (Ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    29527 (Ptgs2)
   04064 NF-kappa B signaling pathway
    29527 (Ptgs2)
   04668 TNF signaling pathway
    29527 (Ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    29527 (Ptgs2)
   04657 IL-17 signaling pathway
    29527 (Ptgs2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    29527 (Ptgs2)
   04913 Ovarian steroidogenesis
    29527 (Ptgs2)
   04921 Oxytocin signaling pathway
    29527 (Ptgs2)
  09156 Nervous system
   04726 Serotonergic synapse
    29527 (Ptgs2)
   04723 Retrograde endocannabinoid signaling
    29527 (Ptgs2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    29527 (Ptgs2)
   05206 MicroRNAs in cancer
    29527 (Ptgs2)
   05204 Chemical carcinogenesis
    29527 (Ptgs2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    29527 (Ptgs2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    29527 (Ptgs2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29527 (Ptgs2)
   05165 Human papillomavirus infection
    29527 (Ptgs2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    29527 (Ptgs2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     29527 (Ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 29527
NCBI-ProteinID: NP_058928
RGD: 620349
Ensembl: ENSRNOG00000002525
UniProt: P35355
LinkDB All DBs
Position
13q21
AA seq 604 aa AA seqDB search
MLFRAVLLCAALALSHAANPCCSNPCQNRGECMSIGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNSIMRYVLTSRSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGT
NMMFAFFAQHFTHQFFKTDQKRGPGFTRGLGHGVDLNHVYGETLDRQHKLRLFQDGKLKY
QVIGGEVYPPTVKDTQVDMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFNIEDQEYTFKQFLYNNSILLEHGLAHFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YHDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFRIINTASIQSLICNNVKGCPFASFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcttccgagctgtgctgctctgcgctgccctggcgctcagccatgcagcaaatcct
tgctgttccaacccatgtcaaaaccgtggtgaatgtatgagcataggatttgaccaatat
aaatgtgactgtacccggactggattctacggtgaaaactgtactacgcctgagtttctg
acaagaatcaaattactgctgaagcccaccccaaacacagtacactacatcctgacccac
ttcaagggagtctggaacattgtgaacaacattcccttccttcggaattcaatcatgaga
tacgtgttgacgtccagatcacatttgattgacagcccaccaacttacaatgtgcactac
ggttacaaaagttgggaagctttctccaacctctcctactacaccagggcccttcctcct
gtggctgatgactgcccaactcccatgggtgtgaaaggaaataaggaacttcctgattca
aaagaagttctggaaaaggttcttctgaggagagagttcatcccggatccccaaggcaca
aatatgatgttcgcattctttgcccagcacttcactcatcagtttttcaagacagatcag
aagcgaggacctgggttcacccgaggactgggccatggagtggacttaaatcatgtttac
ggtgaaactctagacagacaacataaacttcgacttttccaggatggaaaattgaaatat
caggtcatcggtggagaggtgtatcctcccacagtcaaagacactcaggtagacatgatc
taccctccccacgtccctgagcacctgcggttcgctgtggggcaggaagtctttggtctg
gtgccgggtctgatgatgtatgctaccatctggcttcgggagcacaacagagtgtgtgat
atactcaaacaggagcatcctgagtgggatgacgagcgactgttccaaaccagcaggctc
atactgataggagagacgatcaagatagtgatcgaagactacgtgcaacacctgagcggt
taccacttcaaactcaagttcgacccagagctgcttttcaaccagcagttccagtatcag
aaccgcattgcctctgaattcaacacactctatcactggcatccgctgctgccggacacc
ttcaacattgaagaccaggagtacactttcaaacagtttctctacaacaactccatcctc
cttgaacacggacttgctcactttgttgagtcattcaccagacagattgctggccgggtt
gctgggggaaggaatgttccaatcgctgtacaagcagtggcaaaggcctccattgaccag
agcagagagatgaaataccagtctctcaatgagtaccgcaaacgcttctccctgaaacct
tacacatcgtttgaagaacttacaggagagaaagaaatggctgcagagttgaaagccctc
taccatgacatcgatgccatggaactgtatcccgccctgctggtggaaaagcctcgtcca
gatgctatctttggggagaccatggtagaacttggagctccattctccttgaaaggcctt
atgggtaatcccatctgttctcctcaatactggaaacctagcaccttcggaggagaagtg
ggttttaggatcatcaacactgcctcaattcagtctctcatctgcaataatgtgaaaggg
tgtccctttgcctctttcaatgtgcaagacccgcagcctaccaagacagccaccatcaac
gcaagtgcctcccactccagactagatgacattaaccctacagtactaatcaaaaggcgt
tcaactgagctgtaa

DBGET integrated database retrieval system