KEGG   Rattus norvegicus (rat): 29539Help
Entry
29539             CDS       T01003                                 

Gene name
Aldh2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00053  Ascorbate and aldarate metabolism
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00561  Glycerolipid metabolism
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
Module
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    29539 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    29539 (Aldh2)
   00620 Pyruvate metabolism
    29539 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    29539 (Aldh2)
   00561 Glycerolipid metabolism
    29539 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    29539 (Aldh2)
   00310 Lysine degradation
    29539 (Aldh2)
   00330 Arginine and proline metabolism
    29539 (Aldh2)
   00340 Histidine metabolism
    29539 (Aldh2)
   00380 Tryptophan metabolism
    29539 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    29539 (Aldh2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     29539 (Aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235 HetR_C
Motif
Other DBs
NCBI-GeneID: 29539
NCBI-ProteinID: NP_115792
RGD: 69219
Ensembl: ENSRNOG00000001344
UniProt: P11884
LinkDB All DBs
Position
12q16
AA seq 519 aa AA seqDB search
MLRAALSTARRGPRLSRLLSAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVN
PSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIV
PGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQ
GPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIF
GPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGA
QSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgccgcactcagcaccgcccgccgtgggccacgcctgagccgcctgctgtcc
gccgccgccaccagcgcggtgccagcccccaaccagcagcccgaggtcttctgcaaccag
atcttcattaacaatgagtggcatgatgctgtcagcaagaaaacattccccaccgtcaac
ccttccacgggggaggtcatctgccaggtagccgaagggaacaaggaggacgtagacaag
gcagtgaaggccgctcaggcagccttccagctgggctcgccctggcgccgcatggatgca
tctgacaggggccggctgttgtaccgattggctgatctcatcgaacgggaccggacctac
ctggcggccttggagaccctggacaacggcaagccttatgtcatctcctacctggtggat
ttggacatggttctgaaatgtctccgctattatgctggctgggctgacaagtaccacggg
aaaaccattcccatcgatggcgacttcttcagctacacccgccacgagcctgtgggcgtg
tgtggacagatcattccgtggaacttcccgctcctgatgcaagcctggaagctgggccct
gccttggcaactggaaacgtggtggtgatgaaagtggccgagcagacaccgctcactgca
ctctacgtggccaacttgatcaaggaggcaggcttcccccctggtgtggtcaatattgtt
cctggattcggccctaccgccggggctgccatcgcgtcccacgaggatgtggacaaagtg
gccttcacaggttccactgaggttggtcacctaatccaggttgccgccgggagcagcaat
ctcaagagagtaaccctggaactggggggaaagagccccaatatcatcatgtcagacgct
gacatggactgggctgtggaacaggcccactttgccctgttcttcaaccagggccagtgc
tgttgtgcgggctcccggaccttcgtgcaggaggatgtgtatgatgaattcgtggaacgc
agtgtggcccgggccaagtctcgggtggtcgggaaccctttcgacagccggacggagcag
gggccgcaggtggatgagactcagtttaagaagatcctgggctatatcaagtcaggacaa
caagaaggggcgaagctgctgtgcggtgggggcgccgccgcagaccgtggttacttcatc
cagcccaccgtgttcggagacgtcaaagatggcatgaccatcgccaaggaggagatcttc
ggaccagtgatgcagatcctcaaattcaagaccattgaggaggttgtggggcgagccaat
aattccaagtacgggctggctgccgctgtcttcacaaaggacctggacaaggccaattac
ctgtcccaagctctgcaggctgggactgtgtggatcaactgctacgatgtgtttggggcc
cagtccccatttggtggctataagatgtcggggagcggcagggagctgggcgagtatggc
ctgcaggcctacacggaagtgaagacggtcaccgtcaaagtgccacagaagaactcgtaa

DBGET integrated database retrieval system