KEGG   Rattus norvegicus (rat): 296152Help
Entry
296152            CDS       T01003                                 

Gene name
Tgm6, RGD1565348
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     296152 (Tgm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 296152
NCBI-ProteinID: XP_008760458
RGD: 1565348
Ensembl: ENSRNOG00000006830
LinkDB All DBs
Position
3q36
AA seq 706 aa AA seqDB search
MAGVRITKVDWQHSENGAAHHTQDYPCPELVVRRGQLFSLTLDLNRALDSEEALIFTVET
GPHASEALHTKAIFQTAELEIGDTWTAAKEEQTENTITVSLSSPSNAVIGRYLLSARAAS
RRKHSDRKLGQFILLFNPWCPEDDVFLDSEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPSHQDDPATDVSHRHDPVYVTRIISAMVNSNNDRGVVQGQWQG
KYGGGTNPLNWRGSVAILQKWFKGKYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDGNLSVDKYVDSYGRTLEDLTEDSMWNFHVWNESWFARQDLGSSYDGWQVLDATPQ
EESEGTFQCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDKRRERVYSDTKKI
GRCISTKAVGSDSRVDITGLYKYPEGSRKERQVYGKALKKLLSVEAWGRRRRIRRASVRG
IWRDDLLEPVTKPSITGKFKVLEPPVLGQDLKLALCLTNLTTRAQRVRVNVSGATILYTR
KPVAEILRESHTMKLGPLEEKRIPVTISYSQYKEDLTEDKKILLAAMCLVSKGEKLLVEK
DITLEDFITIKVLGPAVVGVTVAVEVLVINPLSESVKDCVLMVEGSGLLQGQLSVEVPSL
KPQERALIQFNITPSKSGPRQLQVDLVSSQFPDIKGFVIIHVATAK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggtcagaatcaccaaggtggactggcagcattcagaaaatggtgctgcccac
cacacccaagactacccttgccctgagctggtggttcgaaggggccagttattcagtctg
accctggatctgaatagagccctggacagcgaggaggccctcatcttcaccgtggagaca
ggaccccacgcatctgaggctctccacaccaaagccatattccagacagcagagctagaa
ataggggacacctggacagctgcaaaggaggaacagacagagaatacaatcaccgtcagc
ctctccagcccttccaatgcagtcattggccggtacctgctgagtgccagggccgcttcc
cgcaggaaacacagtgaccgaaagctgggccagttcattctcctgttcaatccctggtgc
ccagaggatgatgtgtttctggactcagaggaggagaggcaggagtacgtgcttaacgac
agtggcatcatcttccgaggcgtggagaagcacatccgagcccagggctggaactacggg
cagtttgaagaggacatcctgaacatctgcctctccatcctggaccgaagtcccagtcac
caggatgacccagccaccgacgtgtcccaccgccatgacccggtctacgtcaccaggatc
atcagtgccatggtgaacagcaacaatgaccgtggtgtggtacaaggccagtggcagggc
aaatatggcggtggcaccaacccactgaactggcgtggcagtgtggccatcctgcagaag
tggttcaagggcaagtacaagccagttaaatatggtcagtgctgggtcttcgctggcgtc
atgtgcacagtcctcaggtgcctggggatcgcaaccagggtggtgtccaacttcaactca
gcccacgacaccgatggcaatctgagtgtggacaaatatgtggactcttatggccgaacc
ctggaggacctgacagaagacagcatgtggaattttcacgtctggaacgagagctggttt
gcacgacaggacctgggttcatcctatgatggctggcaggttctggatgccacgccccaa
gaggagagcgaaggtacgttccagtgtggccctgcctcggtcactgccatccgtgagggt
gatgtgcatctagcccacgacggccccttcgtctttgccgaggtcaatgcggactacatc
acctggctgtggcacgaggacaagaggcgggagcgtgtgtactcggacaccaagaagatt
ggcaggtgcatcagtaccaaggcggtgggcagtgactcccgtgtggacatcacaggcctc
tacaagtatccagaagggtcacggaaggagaggcaggtgtacggcaaagctttgaagaaa
ctgctcagcgtggaagcctgggggaggagacggcggatccgcagggccagtgtgcgtggc
atctggcgcgatgacctcctggaacctgtcaccaaacccagcatcactggcaagttcaaa
gtgctggagccgccggtgctcggccaggacctgaagctggctttgtgcttgaccaacctc
accaccagggcccagcgggtccgagtcaatgtgagcggggccaccatcctctatacccgc
aagccggtagcagagatcttgcgggaatcccacaccatgaagctggggccactagaagag
aagaggatcccagtcacaatatcttactctcagtacaaagaagacctgacagaagacaag
aagatcctgctggctgccatgtgccttgtcagtaaaggagagaagctcctggtagagaag
gacatcaccctggaggacttcatcaccatcaaggtgctgggaccagcggtggtaggagta
acagttgctgtggaagtcttggtgatcaaccccctctcggaaagcgtaaaggactgtgtg
ctgatggtagagggcagtggccttctccaaggacagctcagtgttgaggtgcccagcttg
aagcctcaggagagggccttgatccaattcaacataaccccctccaagagcggcccaagg
cagctgcaggtggaccttgtcagctcacagttcccagacatcaagggctttgtgattatc
catgtggctacagccaagtga

DBGET integrated database retrieval system