KEGG   Rattus norvegicus (rat): 29660Help
Entry
29660             CDS       T01003                                 

Gene name
Pnck, Camk1b
Definition
(RefSeq) pregnancy up-regulated nonubiquitous CaM kinase
  KO
K08795  pregnancy upregulated non-ubiquitously expressed CaM kinase [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29660 (Pnck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     29660 (Pnck)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   29660 (Pnck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 29660
NCBI-ProteinID: NP_058971
RGD: 69249
Ensembl: ENSRNOG00000058317
UniProt: O70150
LinkDB All DBs
Position
Xq37
AA seq 343 aa AA seqDB search
MLLLKKQTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVEN
EIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQV
LGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVA
PELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS
ESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAALDRDILGSVSEQIQKNFARTHWKRA
FNATSFLRHIRKLGQSPEGEEASRQGMTRHSHPGLGTSQSPKW
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctcaagaaacagacggaggacatcagcagtgtctatgagatccgggagaag
ctgggctcgggtgccttctctgaggtgatgctggcccaggaaaggggctctgctcatctt
gtggccctcaagtgcattcccaagaaagcacttcggggcaaggaggccctggtggagaat
gagatcgcagtactccgcaggattagccaccccaacattgtggctctggaggacgtccac
gagagcccttcccatctctacttggccatggagctggtaacaggtggtgaactgtttgac
cgaatcatggagcggggctcctacacagagaaggatgcgagccaccttgtagggcaggtc
cttggtgctgtctcctaccttcatagcctgggcatcgtgcaccgggacctcaagcctgaa
aacctcctctatgccacaccttttgaggactccaagatcatggtctctgactttggcctg
tccaaaattcaagctggcaacatgctaggcacagcctgtgggaccccaggatatgtggcc
ccagagctcctggagcagaaaccctacgggaaggccgtagatgtgtgggccctgggtgtc
atctcctacatcctgctgtgtgggtacccccccttctatgatgagagcgatcctgaactc
ttcagccagattctgagggccagctacgagtttgactctcccttttgggatgacatctca
gaatcagccaaagacttcattcggcaccttctggaacgtgatccccagaagaggttcacc
tgccaacaggccttacagcatctctggatctctggggatgcagccttggacagggacatc
ctaggttctgtcagtgagcagatccagaagaattttgccaggacccactggaagcgtgca
ttcaatgccacatcattcctacgtcacatccgtaagctgggacagagcccagagggtgag
gaggcctccaggcagggtatgacccgtcacagccacccaggccttgggactagccagtct
cccaagtggtga

DBGET integrated database retrieval system