KEGG   Rattus norvegicus (rat): 298596Help
Entry
298596            CDS       T01003                                 

Gene name
Sdhb
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    298596 (Sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    298596 (Sdhb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    298596 (Sdhb)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    298596 (Sdhb)
   05012 Parkinson disease
    298596 (Sdhb)
   05016 Huntington disease
    298596 (Sdhb)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    298596 (Sdhb)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     298596 (Sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 298596
NCBI-ProteinID: NP_001094009
RGD: 1308598
Ensembl: ENSRNOG00000007967
UniProt: P21913
LinkDB All DBs
Position
5q36
AA seq 282 aa AA seqDB search
MAAVVGVSLKRGFSATALGRVGLQFQACREAQTAAAAAPRIKTFAIYRWDPDKAGDKPRM
QTYKVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRID
TDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDRE
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPF
SLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcggggtctccttgaagcgcggcttttcggctacggctctcggcaga
gtcggcctgcagtttcaggcctgccgagaggcacagacagctgctgctgcagctcccaga
atcaaaaccttcgccatttaccgatgggacccggacaaggctggagataaacctcgaatg
cagacatacaaggtggatctgaataagtgtggaccgatggtgctggatgctctaatcaag
attaagaatgaaatcgattctactttgaccttccgaagatcatgcagagaagggatctgt
ggctcttgtgccatgaacatcaacggaggcaacacgctggcatgcacgcgcaggatcgac
acagaccttggcaaagtctcgaaaatataccctcttccgcatatgtatgtgatcaaggat
ctagtccctgacttgagtaacttctatgcacaatacaaatccattgagccctatctgaag
aagaaggatgagtcccaggagggcaagcaacagtatctgcaatccatcgaggaccgggag
aagctggacggattgtatgagtgcatcctgtgtgcctgctgcagcaccagctgtcccagt
tactggtggaacggagacaagtacctggggcctgcagttctcatgcaggcttatcgctgg
atgatcgactccagagatgaattcacagaggagcgcctggccaagctgcaggaccccttc
tctctctaccgctgccacaccatcatgaactgtacacagacctgccccaagggtctgaat
ccaggaaaagcaattgcagaaatcaagaagatgatggcgacctacaaggagaagcgggca
ttggcttaa

DBGET integrated database retrieval system