KEGG   Rattus norvegicus (rat): 300122Help
Entry
300122            CDS       T01003                                 

Gene name
Ribc2, RGD1309033
Definition
(RefSeq) RIB43A domain with coiled-coils 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 300122
NCBI-ProteinID: NP_001013971
RGD: 1309033
Ensembl: ENSRNOG00000033502
UniProt: Q6AXN9 R9PXY2
LinkDB All DBs
Position
7q34
AA seq 377 aa AA seqDB search
MEVAIPKDLQQEASLAKKRYMDLCRQGQIFDARNRIIGGDTQAWDVQVRNQKIKEVTEKA
RDETFAAEMRHNDKVMCIMHDRELRHRKQLCRAINDFQQRFQKPETRREFDLSDPLALKK
ELPARVSDNDMRNTISGMQKFMGEDLNFQERKRIQKEQNREWSLQQHGEWERAQAEHKLA
EHLHTQTELKFDEAARDLQRLEITTRKAVCAAVKEFNKKQVVELAERKRQVKQQEQEDNM
SEITNLLHGDLLSENPQQAASNFGPRHVMLDRWKGMNREQLEEIWSTWKQQIHEKLRLQE
EERQHNMDWDLRRTRKAHASLLQERQQQRLLREQRRALDCSNLSLAKQQYLQKRQLDAAP
SSQPTEDYFSQFNTRSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggtagcaattcctaaagacctacaacaggaggccagcctagccaagaagcggtac
atggacctgtgcaggcagggacagatcttcgacgccagaaacaggatcattgggggagac
acacaagcctgggatgttcaagttcgtaaccagaagataaaagaagtaactgaaaaagct
agggatgaaacctttgctgccgaaatgaggcacaatgacaaagtcatgtgcataatgcat
gaccgggaactgaggcacaggaagcagctatgtagagctatcaatgacttccagcagcgt
tttcagaagccagaaactcgccgtgaatttgatctttctgaccccctggcccttaagaaa
gagcttccagcccgggtttcagacaatgacatgcggaacaccatatcaggcatgcagaag
ttcatgggggaggatttaaacttccaagagaggaagagaatccagaaggaacagaaccga
gaatggtctctgcagcagcacggggaatgggagcgagcccaggctgaacacaaactggca
gaacacctccacacacagacggaactaaagtttgatgaagcagccagagacttgcagagg
ctggaaatcaccaccaggaaggcagtctgcgcagcagtgaaagagttcaacaagaaacag
gttgtggagttggcagaaaggaagaggcaagtgaaacaacaagaacaagaggataacatg
agcgagatcaccaacctgctgcatggggacctactctctgagaaccctcagcaggcagcc
agcaactttggacctcgccatgtgatgcttgaccgctggaagggcatgaaccgggagcag
ttggaggagatctggtcaacatggaagcagcaaatccatgagaaactgaggcttcaggag
gaagagcgccagcacaacatggactgggacctgcgcaggacccggaaggctcatgccagc
ctgctgcaggagcgacaacagcagcgtttgttgcgggaacagcgcagggccttggactgc
agcaacctcagcctggccaagcagcagtatttacagaaaagacaattggatgcagccccc
tcaagtcaacccacagaagactatttctcacagtttaatacaagaagccgctaa

DBGET integrated database retrieval system