KEGG   Rattus norvegicus (rat): 300615Help
Entry
300615            CDS       T01003                                 

Gene name
Olr1314
Definition
(RefSeq) olfactory receptor 1314
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    300615 (Olr1314)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    300615 (Olr1314)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    300615 (Olr1314)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 300615
NCBI-ProteinID: NP_001000468
RGD: 1334386
Ensembl: ENSRNOG00000006035
UniProt: D4A7M9
LinkDB All DBs
Position
8q22
AA seq 305 aa AA seqDB search
MANRTLLDEFILLGIPQTQGLETLLFVVFLFIYFFTLLGNSLIFTAIVSSSSLHTPMYFF
LGLLSIFDIMFPSVTCPKMLFYLSGQSPAISYKGCVAQLFFYHFLGSTEGCLYSVMAYDR
YVAICHPLRYMLIMKPGVCLSLVTVSWLVGCLQSSILTFFTFQLTYCGPNHVHHFFCDIP
AVLPLACTDNKLAQKVGSINVGFLALMLLFSVCVSYVHIGVAILRIRSAEGRQKAFSTCS
AHLTAILCAYGPVIIIYLQRTPNPLLGAVVQILNNIVSPMLNSLIYSLRNKEVKRSLRRV
FHTLA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcgcacattgctggatgaatttattctcctaggaataccccagactcaagga
ctggagactctactctttgtggtgttcttgttcatatacttcttcaccttgcttggaaat
tcactcatctttacagcaatagtttcttcatcttctcttcacacccccatgtatttcttc
ctgggacttctatcaatttttgacataatgtttccatcagtaacctgtcccaagatgcta
ttttacctctctggccagagtccagccatctcttacaaaggctgtgttgcacagctcttc
ttttatcattttctgggttctactgaaggatgcctctactctgtgatggcctatgatcgt
tatgttgccatctgtcacccactaagatacatgctcatcatgaaacctggagtgtgcctg
agcttggtcacagtatcctggttggtaggatgtcttcagtccagcatcctaacattcttt
acatttcagttaacctactgtggtcccaatcatgtccaccattttttctgtgacattccc
gcagttttacctctggcttgtactgacaacaaattggcccagaaggtgggttccatcaat
gttggctttctggctctgatgcttctcttcagtgtttgtgtctcttatgtacatattgga
gttgccattctgagaatccgttcagcagagggcagacagaaagcattctccacctgcagt
gcccacctcactgctattctttgtgcctacggacctgtaatcatcatctatctgcagcgc
acaccaaaccctctgcttggggctgtggtgcagatattaaataatattgtctcacctatg
ttgaactctttaatctattcattgagaaacaaggaagtgaagaggtccttgagaagggtg
tttcacactttagcttag

DBGET integrated database retrieval system