KEGG   Rattus norvegicus (rat): 301005
Entry
301005            CDS       T01003                                 

Gene name
Impdh2
Definition
(RefSeq) inosine-5'-monophosphate dehydrogenase 2
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Module
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    301005 (Impdh2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    301005 (Impdh2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    301005 (Impdh2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     301005 (Impdh2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   301005 (Impdh2)
  Exosomal proteins of breast cancer cells
   301005 (Impdh2)
SSDB
Motif
Pfam: IMPDH NMO CBS FMN_dh His_biosynth NanE ThiG Dus Glu_synthase DUF561
Other DBs
NCBI-GeneID: 301005
NCBI-ProteinID: NP_954530
RGD: 735092
Ensembl: ENSRNOG00000031965
UniProt: Q6P9U9
LinkDB
Position
8
AA seq 514 aa
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMT
KREDLVVAPAGVTLKEANEILQRSKKGKLPIVNESDELVAIIARTDLKKNRDYPLASKDT
KKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLASGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHGLHSYEKRLF
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggcggactacctgattagcggaggcacttcttacgtgccagacgacgggctcaccgca
cagcagctcttcaactgcggggacggcctgacctacaatgactttctcattcttcctgga
tatatcgacttcactgcggaccaggtggacttgacctctgctctaaccaagaagattact
ctgaagacccccttggtttcctcacctatggacactgtcacggaggctggaatggccatc
gcaatggcgcttacaggaggcattggcttcatccaccacaactgcacacctgaattccag
gccaatgaagttcggaaagtgaagaaatatgaacagggattcatcactgaccctgtggtc
cttagccccaaggatcgtgtgcgcgatgtttttgaggccaaagccaggcatggcttctgt
ggtatccccatcacagataccggccggatggggagtcgattggtgggcatcatctcctcg
agggacattgacttcctcaaggaggaagagcatgatcgcttcttggaagagatcatgact
aagagagaagatttagtggtagcccctgccggcgtcactctaaaagaagcaaatgaaatt
ctgcagcgcagtaaaaagggaaagttgcccattgtgaatgagagtgatgagctggtagcc
atcatcgcccggacagacctcaagaagaatcgtgactacccactggcttccaaagatacc
aaaaagcaactactgtgtggggcagccattggcacccatgaggatgacaagtatcggctg
gacttactggcccttgctggtgtggatgtggtagttttggactcttcccagggaaactcc
attttccaaatcaatatgatcaagtacatcaaggaaaaataccccaatctccaggtcatc
ggaggcaatgtagtcactgctgctcaagccaagaacctcatcgacgcaggtgtggacgct
ctgcgagtcggcatgggaagtggttccatctgcatcacccaggaagtgttggccagtggg
cgaccccaagcaacagcagtatacaaggtctctgagtatgcccgtcgcttcggtgtccct
gttattgctgatggaggaatccagaatgtgggtcatattgccaaagctttggctcttggg
gcctctacagtcatgatgggctccctcttggctgccaccactgaggcccctggtgagtac
ttcttctccgatgggatccggctgaagaagtatcgtggtatgggctctcttgatgccatg
gacaaacacctcagcagccagaaccgatatttcagtgaagctgacaagatcaaagtggcc
caaggagtttcaggggcagtgcaggacaaagggtctatccacaagtttgtcccttatttg
attgctggcatccagcattcctgtcaggacattggtgccaagagcttaacccaagtcaga
gccatgatgtactcgggggaacttaaatttgagaagagaacgtcctcagctcaggtggaa
ggtggcgttcacggcctccattcgtatgagaaacggctcttctga

KEGG   Rattus norvegicus (rat): 362329
Entry
362329            CDS       T01003                                 

Gene name
Impdh1
Definition
(RefSeq) inosine-5'-monophosphate dehydrogenase 1
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Module
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    362329 (Impdh1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    362329 (Impdh1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    362329 (Impdh1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     362329 (Impdh1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   362329 (Impdh1)
  Exosomal proteins of breast cancer cells
   362329 (Impdh1)
SSDB
Motif
Pfam: IMPDH NMO FMN_dh CBS His_biosynth NanE ThiG Glu_synthase DHO_dh PcrB G3P_antiterm
Other DBs
NCBI-GeneID: 362329
NCBI-ProteinID: NP_001102089
RGD: 1311108
Ensembl: ENSRNOG00000020032
UniProt: A0A0A0MXZ8
LinkDB
Position
4
AA seq 548 aa
MEEPLSPPPESGLLSPLLQGGGAAAAPEPGARQHPGHETAAQRYSARLLQAGYEPESMAD
YLISGGTGYVPEDGLTAQQLFANADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKT
PLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSP
SHTVGDVLEAKIQHGFSGIPITATGTMGSKLVMTPRIELVVAPAGVTLKEANEILQRSKK
GKLPIVNDQDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAAVGTREDDKYRLDLLTQA
GADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMG
CGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMM
GSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGS
IQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGL
HSYEKRLY
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggaggaaccgctctcacccccaccggagtccgggctactctcgccgctgctgcaggga
ggcggagccgctgctgctccagagcccggagcccggcaacacccgggacatgagaccgcg
gcgcagcggtacagcgcccgcctgctgcaggccggctacgagccggagagcatggcggac
tacctgatcagcggcggcaccggctacgttcccgaggatgggctcaccgcgcagcagctc
ttcgccaacgcggatggcctcacctacaacgatttcctgatcctcccaggattcatagac
ttcatagctgatgaagtggacctgacatcagccctgacccggaagatcacactgaagaca
ccactgatctcgtctcccatggataccgtgacagaggctgacatggccattgcaatggct
ctcatgggaggaattggtttcattcaccacaactgtaccccagagttccaggccaatgag
gtgcggaaggtcaagaagtttgagcaaggcttcatcacagaccctgtggtcctgagccct
tcacataccgtgggtgatgttctggaggccaagatacagcatggcttctctggtatccct
atcaccgcaacgggcaccatggggagcaagctggtgatgacgccgaggatcgagctggtg
gtggctccagcaggtgtgacattgaaagaggcaaatgagattttgcagcgcagcaagaaa
gggaagctgcccatagtcaacgatcaagacgagctggtagccattattgcacgcacagac
ctgaagaagaacagagactaccctctggcctccaaagactcccacaaacagctgttgtgt
ggggcagctgtgggcacccgtgaggatgacaaataccgtctggatttgctcactcaggcc
ggtgctgacgtcatagtactagattcatcccaggggaactcagtatatcagatcgccatg
gtgcactatatcaagcagaagtacccccacctccaggtgattgggggaaacgtggtgaca
gcggcccaggccaagaacttgatcgatgccggtgtggatgggcttcgtgtgggcatgggc
tgtggctccatctgcatcactcaggaagtgatggcctgtggccgaccccagggcactgct
gtctacaaggtggctgagtatgcccggcgctttggggtgccggtaatagctgatggtggt
atccagactgtgggccatgtggtcaaagccctggcgctcggagcctctacagtgatgatg
ggctccttgctggctgctaccacggaggcccctggtgaatacttcttctcagacggggtg
aggcttaagaagtaccgaggcatgggttccctggacgccatggagaagagcagcagcagc
cagaagcgatacttcagtgagggggacaaagtgaagatcgcacagggtgtctcgggctcc
atccaggataaaggctccattcagaagtttgtgccctacctcatagcagggatccagcat
ggctgtcaggatattggggcccaaagcctgtctgtcctgcgatccatgatgtactcagga
gagctcaagtttgagaagcggaccatgtcagcccagatagagggcggtgtgcacggccta
cactcttacgagaagcggctgtactga

DBGET integrated database retrieval system