KEGG   Rattus norvegicus (rat): 301555
Entry
301555            CDS       T01003                                 

Gene name
Cul3
Definition
(RefSeq) cullin 3
  KO
K03869  cullin 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    301555 (Cul3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    301555 (Cul3)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     301555 (Cul3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     301555 (Cul3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 301555
NCBI-ProteinID: NP_001100393
RGD: 1308190
Ensembl: ENSRNOG00000015633
LinkDB
Position
9q34
AA seq 746 aa
MTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVT
EHLINKVPKDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNL
GLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYE
EDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVK
VVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFSRVPNGLKTMCECMSSYLR
EQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESFNNDRLFKQTIAGDFEYFLNLNS
RSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLT
NKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVD
LTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNAT
FYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDI
PERELVRALQSLACGKPTQRVLTKEPKSKEIESGHIFTVNDQFTSKLHRVKIQTVAAKQG
ESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIK
KRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgaccatggatgaaaaatatgtaaacagcatttgggaccttctgaaaaatgcaattcaa
gaaatccagcgtaagaataacagtggtcttagttttgaggagctctatagaaatgcatat
acaatggttttgcataaacatggagaaaagctctacactggactaagagaagttgttact
gaacatctcataaataaggtacccaaagatgtactaaattcattgaataacaactttctt
caaacactaaatcaagcttggaatgatcatcaaacagccatggtgatgattagagacata
ctaatgtatatggaccgtgtatatgtacaacagaataatgtagaaaatgtctacaatttg
ggattaataatttttcgagatcaagttgtacggtatgggtgtattagggatcatcttcgg
caaactttattggatatgattgccagagagaggaaaggagaagttgtagacagaggagca
ataagaaatgcttgccagatgttaatgattttaggtcttgaaggaagatcagtctatgag
gaagattttgaggctccttttttggaaatgtctgcagaattttttcagatggaaagccag
aaatttttagcagaaaacagtgcttcagtatatataaagaaagtagaagctaggattaat
gaggaaatagagcgggtgatgcactgtctcgacaaatccacagaagagcctattgtgaag
gtggtggagagggaactcatttccaagcacatgaagactattgtagaaatggaaaattct
gggctagtacatatgctgaaaaatgggaagacagaagaccttgcttgtatgtacaaatta
tttagtcgtgtgccaaatggtttgaagacaatgtgtgaatgtatgagttcttatttgagg
gaacaaggaaaagcccttgtttctgaggaaggagaagggaagaatcctgttgactatatc
cagggcttattggatctgaagagtaggtttgatcgcttccttcaagaatccttcaataat
gaccgactctttaaacagactattgctggggactttgagtatttcttaaacctcaactcc
aggtctcctgaatacctctcattatttattgatgataagctgaaaaagggagtcaaaggg
ctaacagaacaggaagtagaaacgatattggataaggcaatggtcctttttaggtttatg
caagaaaaagatgtatttgaacgttactataaacaacatctggcaagaagactgctcaca
aataaaagtgtttctgatgactctgaaaaaaatatgatttctaaattaaagactgagtgt
ggatgtcaattcacatcgaaactggaaggaatgtttagggatatgagcatctcaaacaca
actatggatgagttcaggcaacatctacaggcaacgggggtatctttaggtggagttgat
ctcacagtccgggttctcacaacgggatattggcctactcagtcagccacaccaaagtgc
aacatcccacctgctccaagacatgcttttgagatatttagacggttctatttagccaaa
cacagtggtcggcagctcacactccagcatcacatgggttctgcagatctcaatgccacc
ttttatggtccagttaaaaaggaagatggatctgaggttggtgttggcggtgcacaagta
actggttctaatacacggaagcacatactgcaagtctccactttccagatgaccatatta
atgctttttaataatagagagaaatacacatttgaggaaattcaacaagagactgatatc
cctgaaagagaacttgttagagccctccagtccctcgcctgtggtaaaccaacacagcgg
gtcctcacaaaagaacccaagtccaaggagatagaaagtggccacatatttacagttaat
gatcaattcacatccaaactacacagagtcaagattcaaacagttgcagccaaacaaggt
gaatctgacccagaaaggaaagaaacaagacagaaagtagatgatgacagaaaacacgag
atagaagctgctatagtgcggataatgaagtctaggaagaagatgcagcacaatgtttta
gtagcagaggtaactcagcaactgaaggctcgattcttaccaagtccagttgttattaag
aaacgtattgaaggacttattgagagagaatatttggcacgaacacctgaggatcgcaaa
gtatacacatacgtagcataa

DBGET integrated database retrieval system