KEGG   Rattus norvegicus (rat): 303024
Entry
303024            CDS       T01003                                 

Gene name
Fbxw11
Definition
(RefSeq) F-box and WD repeat domain containing 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04390  Hippo signaling pathway
rno04710  Circadian rhythm
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    303024 (Fbxw11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    303024 (Fbxw11)
   04340 Hedgehog signaling pathway
    303024 (Fbxw11)
   04390 Hippo signaling pathway
    303024 (Fbxw11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    303024 (Fbxw11)
   04218 Cellular senescence
    303024 (Fbxw11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    303024 (Fbxw11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    303024 (Fbxw11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    303024 (Fbxw11)
   03036 Chromosome and associated proteins [BR:rno03036]
    303024 (Fbxw11)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     303024 (Fbxw11)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     303024 (Fbxw11)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 WD40_like DUF1513
Other DBs
NCBI-GeneID: 303024
NCBI-ProteinID: NP_001100463
RGD: 1309121
Ensembl: ENSRNOG00000004395
UniProt: D3ZXC6
LinkDB
Position
10q12
AA seq 386 aa
MPGLCVQQSWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIEIWDKSSLECLKVLTGHTGSV
LCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIA
VWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHK
RGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDG
KIKVWDLQAALDPRAPASTLCLRTLVGFLVLNYWLHGYHMPKGVHSFTAEFWGWTWFQML
GRHRAAPPSSPDISHCAPALLGEGLLSSSLRVGQQLMPLPSVKTPALPTHTFPRRTQQRP
SGEALLLIYVVALRLGLVLKAALCSW
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgccaggtctctgtgtgcagcagagctgggatcagtacctgtttaaaaacagacctaca
gatggccctcccaactcattttatagatcattatacccaaagattatccaggacatagag
atctgggataaaagcagcttggaatgtttgaaagtgctaacgggacacacgggctctgtc
ctctgcctccagtatgatgaacgagtcattgtaactggttcttcagactctacagtgaga
gtctgggatgtgaacacgggggaagttctcaacacactcatccaccacaacgaagccgtg
ctgcacttacgcttcagcaacggactgatggtgacttgttccaaggaccgctccatcgct
gtgtgggacatggcttctgccactgatatcactttacgccgtgtcctggttggccaccgt
gctgctgtcaatgtagtagactttgatgataagtacatcgtgtctgcctctggagacagg
actattaaagtgtggagcacgagcacctgtgagttcgtccgcactctgaatgggcacaag
cgaggcattgcctgtctgcagtaccgggaccggcttgttgttagtggatcatcagataat
accatccggttatgggatattgaatgtggtgcctgtttaagagtcctagaggggcacgaa
gagttggtccggtgcatccgttttgataacaagaggattgtcagtggcgcctatgacggg
aagattaaagtctgggatttgcaggctgctcttgaccctcgggccccagcaagcacattg
tgtctgcgcaccttggtgggtttcctggtcttgaactactggctacatggctatcacatg
cctaagggagttcattcgttcacggctgagttttggggctggacttggttccagatgctg
ggtagacacagagcagccccaccctctagccccgacatttctcactgcgccccagctcta
cttggagaaggacttcttagctcatccctgcgagtagggcagcagctcatgcccctccct
tccgtgaagaccccagcgcttccgacgcacacgttcccaagaaggacacagcaaaggccg
tcaggagaagccctgcttctgatttacgtcgtcgctttgcgccttggtttggtactaaaa
gcagccttgtgttcttggtga

KEGG   Rattus norvegicus (rat): 361765
Entry
361765            CDS       T01003                                 

Gene name
Btrc, beta-TrCP1
Definition
(RefSeq) beta-transducin repeat containing E3 ubiquitin protein ligase
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04390  Hippo signaling pathway
rno04710  Circadian rhythm
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    361765 (Btrc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    361765 (Btrc)
   04340 Hedgehog signaling pathway
    361765 (Btrc)
   04390 Hippo signaling pathway
    361765 (Btrc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    361765 (Btrc)
   04218 Cellular senescence
    361765 (Btrc)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    361765 (Btrc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    361765 (Btrc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361765 (Btrc)
   03036 Chromosome and associated proteins [BR:rno03036]
    361765 (Btrc)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     361765 (Btrc)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     361765 (Btrc)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160 F-box_5 DUF4508
Other DBs
NCBI-GeneID: 361765
NCBI-ProteinID: NP_001007149
RGD: 1359721
Ensembl: ENSRNOG00000016280
UniProt: Q5U4E5
LinkDB
Position
1q54
AA seq 619 aa
MDPAEAVLQEKALKFMAAVPAGGYWRNNKKCSMPRSLWLGCSSLADSMPSLRCLYNPGTG
ALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCINQETVCLTSTAMKTENCV
AKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHG
HINSYLKPMLQRDFITALPARGLDHIAENILSYLDARSLCAAELVCKEWYRVTSDGMLWK
KLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDENAPPNSFYRALYPKIIQDIETIESNW
RCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSV
LCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIA
VWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHK
RGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDG
KIKVWDLMAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDP
ATHAEPPRSPSRTYTYISR
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggacccggcagaggcggtgctgcaggagaaagcgctcaagtttatggctgcagttccg
gctggtggatattggaggaataataaaaagtgctctatgcccaggtctctgtggctgggc
tgctccagcctggcggacagcatgccctcgctgcgatgcctgtataacccagggactggc
gcactcacagctttccagaattcctcagagagagaagactgtaataatggcgaaccccct
aggaagataataccagagaagaattcacttagacagacttacaacagctgtgccaggctc
tgcataaaccaagagacagtatgtctaacaagcactgctatgaagactgaaaattgtgtg
gccaaaacaaaacttgccaatggcacctccagcatgattgtgcccaagcagcggaaactc
tcagcaagctatgagaaggaaaaggagctgtgtgtcaagtactttgagcagtggtcagag
tctgatcaagtggaatttgtagaacaccttatatctcaaatgtgtcattaccagcatggg
cacatcaactcctatctaaagcctatgctgcagagggatttcataactgcactgccagca
cggggtctggaccatattgctgagaacattctgtcatacttggacgccagatcactgtgt
gctgctgagcttgtgtgcaaggaatggtaccgcgtgacgtcggacggcatgctgtggaag
aagctcatcgagaggatggtcaggacagactctctgtggcgaggcctggcagagcgcaga
gggtggggacaatacttattcaaaaacaaacctcctgatgagaatgcgcctcccaactcc
ttttatagagcgctttatcctaaaattatacaagacattgagacaatagagtccaattgg
agatgtgggcgacacagtttacagagaatccactgccggagtgaaacaagtaaaggggtc
tactgtttacagtatgatgaccagaagatagtcagtggccttcgagacaacaccatcaag
atctgggataaaagcacactggaatgcaagcggattctcacaggccacacaggctctgtc
ctgtgtctgcagtatgacgagagggtgatcatcacgggctcctcagactccaccgtcaga
gtgtgggacgtaaatgcaggggagatgctaaacacattgattcaccactgtgaagccgtc
ctgcacctgcgcttcaataacggcatgatggtgacctgctccaaagaccgatccattgct
gtgtgggatatggcttccccaactgacatcaccctcaggagggtgctggtgggccaccga
gctgcggtcaatgttgtcgactttgatgacaagtacatcgtttctgcctctggagacaga
accataaaggtgtggaacacaagtacctgtgaatttgtaaggaccctaaatgggcacaag
cgtggtatcgcctgtttgcagtacagagacaggctggtggtgagcggctcctctgacaac
accatcaggctgtgggacatagagtgcggtgcatgtctgcgagtgttggaaggccatgag
gaattggtacgctgtattcgatttgataacaaaaggatagtgagtggggcctatgatgga
aaaattaaagtgtgggatcttatggctgctctggacccgcgtgctcctgcagggactctt
tgtctacggacgcttgtggagcattctggaagagttttccgactccagtttgatgaattc
cagattgtcagtagttcacatgatgacacaattctcatctgggacttcctaaatgatcca
gccactcatgctgaaccgccccgctccccttctcggacatacacctacatctccagataa

DBGET integrated database retrieval system