KEGG   Rattus norvegicus (rat): 303179
Entry
303179            CDS       T01003                                 

Gene name
Guk1
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Module
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    303179 (Guk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     303179 (Guk1)
SSDB
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 RsgA_GTPase AAA_22 MMR_HSR1 ABC_tran DUF2075 NACHT AAA_28 Rad17 AAA_14 dNK AAA_29 AAA_30 VirE RNA_helicase cobW AAA NTPase_1 Radical_SAM_2 TsaE AAA_17 NB-ARC Zeta_toxin AAA_24 KAP_NTPase Viral_helicase1
Other DBs
NCBI-GeneID: 303179
NCBI-ProteinID: NP_001013133
RGD: 1309638
Ensembl: ENSRNOG00000002928
UniProt: Q71RR7 E9PTV0
LinkDB
Position
10
AA seq 219 aa
MLRRPLVGLAVAALGRVPVDGMAGPRPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHT
TRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICV
LDVDLQGVRSIKKTDLHPIYISVQPPSMDVLEQRLRQRNTETEESLAKRLAAAQADMESS
KEPGLFDLVIVNDNLDEAYVTLKQALSEEIKKAEGTEHA
NT seq 660 nt   +upstreamnt  +downstreamnt
atgctgcggcgcccgctggtcgggctggcggtggccgccctgggtcgcgttcccgtggac
ggcatggcaggacctaggccagtagtgctgagcgggccatcaggggcagggaagagcact
ctgctcaagaagttgttccaggaacatggcagtgtctttggcttcagcgtatcccacact
acaaggaacccacgacctggcgaagaagatggcaaagattactactttgtgaccagggag
atgatgcagcgtgatattgcagcaggggacttcattgagcatgctgagttctcagggaac
ctgtatgggacaagcaaggaagccgtccgggctgtgcaggccatgaaccgcatctgcgtg
ctagatgtcgacctacaaggagtgcgcagcatcaagaagactgatctgcatcccatctac
atctctgtgcagcctccctcgatggacgtgctggagcaacgactgcggcagcgcaacact
gagactgaggagagcctggcaaagcggctggcagctgcacaggcagacatggagagcagc
aaggagcctggcttgtttgacctggtgatcgtcaatgacaacctggatgaagcctatgtt
acactgaagcaggcactgtctgaggaaatcaagaaagctgagggaactgaacatgcctga

DBGET integrated database retrieval system