KEGG   Rattus norvegicus (rat): 304646Help
Entry
304646            CDS       T01003                                 

Gene name
Mgat4d, RGD1310572
Definition
(RefSeq) MGAT4 family, member D
  KO
K00738  alpha-1,3-mannosylglycoprotein beta-1,4-N-acetylglucosaminyltransferase A/B [EC:2.4.1.145]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00513  Various types of N-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    304646 (Mgat4d)
   00513 Various types of N-glycan biosynthesis
    304646 (Mgat4d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    304646 (Mgat4d)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.145  alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     304646 (Mgat4d)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  N-Glycan
   304646 (Mgat4d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_54
Motif
Other DBs
NCBI-GeneID: 304646
NCBI-ProteinID: NP_001020837
RGD: 1310572
Ensembl: ENSRNOG00000003695
UniProt: Q4V8F8
LinkDB All DBs
Position
19q11
AA seq 372 aa AA seqDB search
MKTKNVNLLFALVAVLLFGFSCFCISRMNQTNNQLINCRNHVLEFKETMLRLKNKSENNH
QNLVKVLHQLKHKVAPAKPSGSILEKKVNMLDQDETVFNQFEVLKFFLPHLRTAGNIYPD
IAIGRQRAGVSFALGITTIDRGNHTYLKQTLTSVLSRMTPEEEEDSVVIVSVADTDENYL
KSVVHMVKTRFRKQVQSGALEVISIPALFYPQTLLEKKTTKNAKNWQIKQVLDFCILMLY
AQPKATYYLQLEDDIVAKKMYFTKMKDFVNSVTSKDWFYIEFSVLGFIGKLFRSKDLMDF
VHFFLIFYRAKPIDVLLDDIALLRMCSFGGPLRSCLQLKREVRVQYKPSLFQHVGTHSSF
PGREQHLKDHYY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaagaacgttaacttgctcttcgctctcgttgctgtcctgctctttggcttc
tcgtgtttctgcatctccaggatgaaccaaaccaataatcagctaattaactgcagaaac
cacgttttggagttcaaggaaactatgctacgtttaaaaaacaaaagtgaaaataatcac
caaaatctagtgaaagtcctccatcaactgaagcataaagtggccccagcgaagccgtca
ggaagcatccttgagaagaaagtgaacatgttggatcaggatgaaacagtttttaaccaa
tttgaagtcttaaagttcttccttcctcacctaaggacagcagggaacatttacccggat
atagccattggcagacagagagcaggcgtctcttttgcactgggaatcaccaccattgac
agagggaatcacacctacctgaagcaaacgctgacttctgttctctccagaatgactcct
gaagaagaggaggactccgtggtgatcgtctctgtggctgatactgatgaaaattattta
aaatctgttgttcacatggttaaaaccagattcagaaagcaagtacagtccggagctttg
gaggtcatttcaatacctgcccttttttaccctcaaacattactggaaaagaaaacaacg
aagaatgcaaaaaattggcagataaaacaagtattggatttttgtattctgatgttgtac
gcacaacccaaggccacgtattatttacagctggaagatgatatcgtagcaaaaaagatg
tattttacaaaaatgaaagattttgtaaatagtgtcacttcaaaagattggttttatatt
gagttttcagtccttggatttatagggaaactctttcgatcgaaggacctgatggacttt
gtgcattttttcttgatattctacagagcaaagcccatagatgtgcttttagatgacatt
gccctgcttcggatgtgcagcttcggggggcctctgaggagctgtttgcagctaaagagg
gaagttcgagttcagtacaaaccatctctgttccagcatgtgggcactcactcatcattt
ccaggacgagaacagcacctcaaggatcattactactag

DBGET integrated database retrieval system