KEGG   Rattus norvegicus (rat): 304987
Entry
304987            CDS       T01003                                 

Gene name
Aim2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    304987 (Aim2)
   04623 Cytosolic DNA-sensing pathway
    304987 (Aim2)
SSDB
Motif
Pfam: HIN PYRIN
Other DBs
NCBI-GeneID: 304987
NCBI-ProteinID: XP_001057147
RGD: 1307283
Ensembl: ENSRNOG00000003480
UniProt: D4A9W0
LinkDB
Position
13q24
AA seq 356 aa
MESDFREMLLLTGLDHITEEELKRFKYLALTEFNIPRKTLNIADRTELADQLIQSAGAAS
AVAKAISIFQKLNYMDIAKALEEKKKEAESKYVTNTKKRGTQKVENRSQAKNCSVASATC
SDKDFKGHSATEVCPQVKPQKKQMVAEQEAIREDLQQDSLVVMVLKAMNPFECETQEGKQ
KIFHATVATETEFFFVKVLNAQFKDKFIPKRTIQISNYLRHSYFVEVTSSSVVVDVESSH
KVCVPNNIMKKAGETPKISKLKTLPCGTIVNGLFKVQKITEQKDRVIYGIHDKRGTMEVL
VLGNQSKTKCEEGDKIRLTFFEVSNNRGKIQLKSGPCSIYKVIKAAKPKTKVKSVE
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggagagtgactttcgggaaatgctgttgttgaccggcctggaccacatcacggaggag
gaactgaaacggttcaagtacttggccctgactgagtttaacattcccaggaagacactg
aacattgcagacaggacggagttagctgaccaactaattcaaagtgcaggagcagcatct
gcggtggcgaaagccattagtatttttcagaagttgaattatatggatattgcaaaggct
cttgaagagaaaaagaaagaagctgaaagtaaatatgtgacaaatacaaagaagagagga
acacagaaagtagaaaatagaagtcaagctaaaaactgttctgttgcttctgccacctgc
agtgacaaagacttcaagggacactctgctacagaagtctgtcctcaagttaagcctcag
aagaaacagatggtggcagaacaggaagccatcagagaagatttacagcaagattcacta
gtagtcatggtgctgaaagctatgaatccctttgagtgtgagacccaggaaggaaaacaa
aagatattccatgccacagtggccacagagacagaatttttctttgtaaaagttttaaat
gcacagtttaaagataaatttattccaaagagaacaattcaaatatcaaattatctccgt
cacagttactttgtggaggtcaccagttcctcagttgtggttgatgttgaatctagccac
aaagtctgcgttcctaataacattatgaagaaagctggagaaactcctaagattagtaaa
ctgaaaactctgccgtgcgggacaattgtgaatggcttatttaaagtccagaagataaca
gagcaaaaagatagagtaatatatggcatacatgacaaaagagggaccatggaggtgttg
gtgcttggaaaccagagcaaaacaaaatgcgaggaaggagacaagattagactcactttc
tttgaggtgtcaaacaatagagggaaaattcagttgaaatctggaccctgtagcatctat
aaggttattaaggctgcaaagcccaaaactaaggtgaaaagtgtggagtga

DBGET integrated database retrieval system