KEGG   Rattus norvegicus (rat): 308345Help
Entry
308345            CDS       T01003                                 

Gene name
Kmt5c, Suv420h2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    308345 (Kmt5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    308345 (Kmt5c)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     308345 (Kmt5c)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     308345 (Kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 308345
NCBI-ProteinID: NP_001100945
RGD: 1305226
Ensembl: ENSRNOG00000017508
UniProt: P0C2N6
LinkDB All DBs
Position
1q12
AA seq 470 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPTLRRQHHLRSALEAFLRQRD
LEAAFRALTLGGWMAHYFQNRAPRQEAALKNHIFCYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREEDEYLLRAGENDFSVMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPSDGNTACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEG
AFRLQPREPELRPRPLDKYELRETKRRLQQCLDSSQQNLLSLRACSHLSPLRPDPFCAAC
QPSCLLPVSPHMDYLPLWLQWVPQPQPRVRPRKRRRRRRRRPRIPQASLSPDLHTACVSL
HRWGGCGPHCQLRAEAMVTLHLLPQTRWTPKQDWYWARRYGLPSVVRVELSPLAPALPAA
PAPAGNLGPTPTPDLIPKQALAFAPFCPPKRLRLVVSHGSIDLDINSGEP
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggggcctgaccgagtgacagcccgagaactgtgcgagaatgatgacctggccaccagc
cttgttcttgacccctacctcggcttccgcacccataagatgaatgtcagccctgtgccc
accctccgacgacaacaccaccttcgctcagcactggaagctttcctaaggcaacgggac
ctggaagctgcattccgggccctgacactgggaggctggatggcccactactttcagaac
cgtgctcctcggcaggaggctgccctcaagaaccacattttttgctacctccgcgccttc
ctgcctgagagtggcttcaccattctgccctgcacccgctactccatggagaccaatggg
gccaagattgtgtctacccgtgcttggaagaagaatgagaagctggagctgctggtgggc
tgcattgcagagctgcgggaagaggatgaatacctacttagggcaggcgagaacgacttc
agcgtcatgtactccactcgaaaaaggagtgcccagctgtggcttggcccagctgccttt
atcaaccatgactgcaaacccaactgcaagtttgtgccctcagatggaaatactgcctgt
gtgaaggtgctacgggacattgagccgggggatgaagtaacttgcttctatggcgagggc
ttcttcggtgagaagaatgagcactgtgaatgctatacctgtgagaggaaaggcgaggga
gctttcagacttcagcccagggagccggagctgaggccacggcccctggacaagtatgag
ctccgagagacaaagaggcgtctgcagcagtgtttggacagcagccagcagaacctgctg
agcctgcgggcctgctcccacctgtccccactgcgccctgacccattctgtgctgcctgc
cagccctcatgcctgctgcctgtcagtccccacatggactacttgcccctctggctccag
tgggtgcctcagccccagcccagagtacgtccccggaagcgccgccgtcgccgccgccgt
cgccccaggataccccaggcttcattgtcccctgacctgcacactgcctgtgtatcccta
caccgatggggaggctgtggtccccactgccaactacgggctgaggccatggtgacccta
cacctgctcccccagactcgctggaccccaaaacaggactggtactgggcccgacgctat
gggctaccttctgtggtgcgcgttgaactttcccctctagccccagccctaccagctgct
cctgctcctgctgggaacctaggtcccacccccacccctgacctcatacctaaacaggcc
cttgccttcgctcctttctgcccacctaagcgcctccggctagtggtcagccatggttct
attgatctggacatcaatagtggtgagccatga

DBGET integrated database retrieval system