KEGG   Rattus norvegicus (rat): 309165
Entry
309165            CDS       T01003                                 

Gene name
Rela, NFkB
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04071  Sphingolipid signaling pathway
rno04137  Mitophagy - animal
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04218  Cellular senescence
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05212  Pancreatic cancer
rno05215  Prostate cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    309165 (Rela)
   04014 Ras signaling pathway
    309165 (Rela)
   04064 NF-kappa B signaling pathway
    309165 (Rela)
   04668 TNF signaling pathway
    309165 (Rela)
   04066 HIF-1 signaling pathway
    309165 (Rela)
   04071 Sphingolipid signaling pathway
    309165 (Rela)
   04024 cAMP signaling pathway
    309165 (Rela)
   04151 PI3K-Akt signaling pathway
    309165 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    309165 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    309165 (Rela)
   04218 Cellular senescence
    309165 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    309165 (Rela)
   04621 NOD-like receptor signaling pathway
    309165 (Rela)
   04622 RIG-I-like receptor signaling pathway
    309165 (Rela)
   04623 Cytosolic DNA-sensing pathway
    309165 (Rela)
   04625 C-type lectin receptor signaling pathway
    309165 (Rela)
   04660 T cell receptor signaling pathway
    309165 (Rela)
   04658 Th1 and Th2 cell differentiation
    309165 (Rela)
   04659 Th17 cell differentiation
    309165 (Rela)
   04657 IL-17 signaling pathway
    309165 (Rela)
   04662 B cell receptor signaling pathway
    309165 (Rela)
   04062 Chemokine signaling pathway
    309165 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    309165 (Rela)
   04917 Prolactin signaling pathway
    309165 (Rela)
   04926 Relaxin signaling pathway
    309165 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    309165 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    309165 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    309165 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    309165 (Rela)
   05202 Transcriptional misregulation in cancer
    309165 (Rela)
   05203 Viral carcinogenesis
    309165 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    309165 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    309165 (Rela)
   05221 Acute myeloid leukemia
    309165 (Rela)
   05220 Chronic myeloid leukemia
    309165 (Rela)
   05215 Prostate cancer
    309165 (Rela)
   05222 Small cell lung cancer
    309165 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease
    309165 (Rela)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    309165 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    309165 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    309165 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    309165 (Rela)
   04931 Insulin resistance
    309165 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    309165 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    309165 (Rela)
   05135 Yersinia infection
    309165 (Rela)
   05133 Pertussis
    309165 (Rela)
   05134 Legionellosis
    309165 (Rela)
   05152 Tuberculosis
    309165 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309165 (Rela)
   05170 Human immunodeficiency virus 1 infection
    309165 (Rela)
   05162 Measles
    309165 (Rela)
   05164 Influenza A
    309165 (Rela)
   05161 Hepatitis B
    309165 (Rela)
   05160 Hepatitis C
    309165 (Rela)
   05168 Herpes simplex virus 1 infection
    309165 (Rela)
   05163 Human cytomegalovirus infection
    309165 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    309165 (Rela)
   05169 Epstein-Barr virus infection
    309165 (Rela)
   05165 Human papillomavirus infection
    309165 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    309165 (Rela)
   05145 Toxoplasmosis
    309165 (Rela)
   05140 Leishmaniasis
    309165 (Rela)
   05142 Chagas disease
    309165 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    309165 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    309165 (Rela)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    309165 (Rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 309165
NCBI-ProteinID: NP_954888
RGD: 727889
Ensembl: ENSRNOG00000030888
UniProt: Q7TQN4
LinkDB
Position
1q43
AA seq 550 aa
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLTPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTEPRPPPRRIAVPSRGPTSVPKPAPQPYAFSTSLSTINF
DEFSPMVLPPGQISNQALALAPSSAPVLAQTMVPSSAMVPSLAQPPAPVPVLAPGPPQSL
SAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNNTDPGVFTDLASVDNSEFQQLLNQ
GVAMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPATLGTSGLPNGLSGDEDFSSIADMD
FSALLSQISS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggacgatctgtttcccctcatctttccctcagagccagcccaggcttctgggccatat
gtggagatcattgagcagcccaagcagcggggcatgcgtttccgttacaagtgcgagggc
cgctctgcaggcagtattcctggggagagaagcacagataccactaagacgcaccccacc
atcaagatcaatggctacacgggaccaggaacagttcgaatctccctggtcaccaaagac
ccacctcaccggcctcatccacatgaacttgtggggaaggactgccgggatggcttctat
gaggctgaactctgcccagaccgatgcatccacagcttccagaacctggggatccagtgt
gtgaagaagcgagacctggagcaagccattagccagcgcatccagaccaacaataacccc
tttcaagttcccatagaggagcagcgcggggactatgacttgaatgcggtccgcctctgc
ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgacccctgtcctctcg
catccgatttttgataaccgtgcccccaacactgccgagctcaagatctgccgagtaaac
cggaactctgggagctgccttggtggggatgagatcttcttgctgtgtgacaaagtgcag
aaagaagacattgaggtgtatttcacgggacctggctgggaggcacgaggctccttttct
caagccgatgtgcaccggcaagtggccattgtgttccgaactcccccatacgctgaccct
agcctgcaggctcctgtgcgagtgtccatgcagcttcggcggccttctgatcgggagctc
agtgagcccatggagttccagtacttgccagacacagacgatcgccaccggattgaagaa
aaacgcaaaaggacctacgagaccttcaagagcatcatgaagaagagtcctttcaatgga
ccaactgaaccccggcctccaccccgacgtattgctgtgccttcccgaggcccaacttct
gtccccaagccagcaccccagccctatgccttttcaacatccctcagcaccatcaacttt
gatgagttttcccccatggtgttaccacctgggcagatctcaaaccaggccttggccctg
gcaccatcctctgccccagtcctggcccagaccatggtcccctcctcagccatggtacca
agtctggctcagcccccagctcctgtcccagttctagccccaggtcctccccaatccctg
tctgcacctgttccaaagagcacccaggcaggggaaggcaccctgtctgaagccctgcta
cacctgcagttcgatgctgatgaagacttgggggccttgcttggcaacaacacagaccca
ggagtgttcacagacctggcatctgtcgacaactcagagtttcagcagcttctgaaccag
ggtgtggccatgtcccactccacagctgagcccatgctgatggagtaccctgaagctata
actcgcctggtgacaggatcccagaggccccctgatccagctcctgcaaccctggggacc
tcagggcttcccaatggcctctcaggggatgaagacttctcctccattgcggacatggac
ttctcagctcttctgagtcagatcagctcctaa

DBGET integrated database retrieval system