KEGG   Rattus norvegicus (rat): 309812Help
Entry
309812            CDS       T01003                                 

Gene name
Rev3l
Definition
(RefSeq) REV3 like, DNA directed polymerase zeta catalytic subunit
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    309812 (Rev3l)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    309812 (Rev3l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    309812 (Rev3l)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     309812 (Rev3l)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    309812 (Rev3l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4683 DNA_pol_B DNA_pol_B_exo1 zf-C4pol Ribosomal_60s GUN4_N
Motif
Other DBs
NCBI-GeneID: 309812
NCBI-ProteinID: NP_001077435
RGD: 1307087
Ensembl: ENSRNOG00000000593
UniProt: F1M8G6
LinkDB All DBs
Position
20q12
AA seq 3132 aa AA seqDB search
MFSVRIVTADYYMASPLPGLDICQSPLTQHPVKKVPVVRVFGATPAGQKTCLHLHGVFPY
LYVPYDGYGQQPERYLSQMALSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKER
HFMKIYLYNPAMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAV
KFRKARRKGDASHATGLFKPQLSGNSPAGTLFRWEEDEIPSSLLLEGVEPLSTCELEVDA
VAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNENSQISQPESQDCRLVPATESEKI
FQKRLQEILKQNDFSVTLSGSVDYSSGSQEFSAELTLHSEILSPEMLPCSPANMIEVHRD
NDWSKGNTKHKVEEALINEEAILNLIENSQTFQPLTQRLSETPVFMDSSPDESLVHLLAG
LESDGYQGEKNRMPLPRHTFGESQNPQNSDDEENAPQMEKEEMELSVLMSQRWDSDTEEQ
CAKKRSLCRNAHRSSTEEDDSSSEEEMEWTDNSLLFANLSIPQLDGTADENSDNPLNNEN
SRAHSSVIATSKLSVRPSVFHKDAATLEPPSSAKITFQCKHTSALSSHGLNKDDLIEGLS
QPNNTEKGRDSSVTFTKESTYSMKYSGSLSSTVHSDNSHKEICKKDKSLPVPSCESSVFD
YEEDIPSVTRQAPSRKYSNMRKIEKDAPFIHANRHTSESTLGKNSFNFADLNHSKNKLSS
EGNERGNSTALNSVFPSSLAESCDLLSSSGENRSVAHSLDSITDESGRSKLKIRYEEFQE
HKMERPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGSKTSRLKLNKKKLISLQ
ETSTKSSETGAAKDSCTHNHPYSGTPEKESGLSSDLIKATHGTFENKTPTEHFIDCHFGD
GSLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGENLDGTLKS
RKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLK
DFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKRKPGKQHRASSENIKRTLSFRKKRT
HAVLSPPSPSYIAETEDCDLNYSDVMSKLGFLSERSTSPVNSSPPRCWSPTDPRAEEIMA
AAEKESVLFKGPNVCNTKTVSPRVGKASRARAQVKKSKARLAKSSVVTNKRNKRNQTNQL
VDNGKKKPRAKQKQRANEKGISRKPVIPTDETTKPPSEAELTPSQRSVPELTSSSGIHTL
SKQKEMTQTGPAMDHPLPPCQPTGINAQQRLSNCFSSFLESRKSVQFPTFPSSRGDSRSS
VYSSIGPGVSKVNTQRSHSQSAMFTRKETTLIQKSIFDLSNHLSQVAQSTQLCSGIISPK
TEESSNTQKNCGSSIGKLNEYRSSLESKPEKVCAPNFLHCRDSQQQTVNVSEQSKPSETC
SPGNAASEESQTPNCFVTSLRSPIKQITWEQRQRGCILEMSSFKPEKVKQRSLSEAISQT
KALSQCKNQNVSTPSVFGEGQSGLAVLKELLQKRQQKAQTTNVQDSASSHQPDKDISVSA
EHKKTNKRTRAVASPRKPRAPRRTKPKEQTPRRLKVDPLNLQTSGHLDNSLSDDSPILFS
DPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSLYSGSQFVPADQNLPQKFLSDAVQDL
FPGQAIEKNELLSHDRQSCTEEKHHVSDSGPWVRASTLNPELFEKVGIDNNENHRHSQWK
TSFHPLTSHSNSIMESFCVQQAESCLPEKSRLNRSSVSKEVFLSLPQASSSDWIQGHNGK
EIEQSLDSANTSFTTVLSSPDGELVDAASEDLELYVSRNNDVLTPTPDSSPRSTSSPLQS
KNGSFTPRTAHILKPLMSPPSREEIVATLLDHDLSEAIYQEPFCSNPSDVPEKPREIGGR
LLMVETRLPNDLIEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRNGPAVVNKESSNSHK
TVEDKKIVIMPCRYAPSRQLVQAWLQAKEEYVRSKRLPRTESTPVIKSADNVSPSLNPGD
TRAVAPQMDTCPHTLSSTAHAKEEVCQSQIALQTSRTGCGQTVSASQTLLPAASAAVPEE
EEEEEEEEEEEEEDENGYVSYSSPDSPGIPPWQQAASPDFRALNGEHRCSSPVEELCSRA
VENFLKPIKDGIQKASCCESQVISPIHARTRTEKCEPLCLHSTPVMPRKFLEKLPEATGL
SPLSVEPKTQKLYNKKGSDTDHLRRVLLTTQVENQFAAVNTPKKETSQIDGPSLNNTYGF
KVSIQNLQEAKALHEIQNLTLISVELHARTRRDLQPDPEFDPICALFYCISSDTPLPDTE
KTELTGVIVIDKDKTVTHQDIRCQTPLLIRSGVTGLEVTYAADEKALFQEVTNIMKRYDP
DILLGYEIQMHSWGYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDDYGSDTMSEINI
VGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVD
HYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIP
VTPSVQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHIE
NLGKYDEFKFGCTSLRVPPDLLYQIRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRF
MVKQSMKAYRQDRALSRMLNARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARE
TLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKL
KFEKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLF
ETRDISLIKQYVQRQCMKLVEGKASIQDFIFAKEYRGSFSYRPGACVPALELTRKMLAYD
RRSEPRVGERVPYVIVYGTPGLPLIQLIRRPAEVLQDPTLRLNATYYITKQILPPLARIF
SLIGIDVFSWYQELPRIQKATSSSRSDLEGRKGTISQYFTTLHCPVCDGLTQHGICSQCR
SQPQHVAIILNQEIRELERQQEQLVKICRNCTGSFDRHIPCVSLNCPVLFKLSRVNRELS
KAPYLRQLLDQF
NT seq 9399 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgtgaggatagtgactgccgactactacatggccagcccgctgccggggctg
gatatctgccaatcccccctcacccagcaccctgtcaagaaggtgccggtggtacgagtc
ttcggggcgaccccggcaggtcagaagacgtgtcttcatctacatggcgtctttccttac
ctctatgtgccatacgatggctatggacagcagccagaacgctatctctctcagatggca
ctcagtatcgacagagcacttaatgtggctttaggcaatccatcttccactgctcagcat
gtgttcaaagtgtcattagtatcaggaatgcctttttatggttatcatgagaaggaaaga
cactttatgaagatctatctttacaatcctgcaatggtgaaaaggatctgtgaacttttg
caaagtggagccataatgaataaattttaccagcctcacgaagcgcatattccctacctc
ctacagctcttcattgactacaatctttatggaatgaatttaataaacctggctgctgtc
aagttccgaaaagcaagaaggaaaggtgatgcctcgcatgcaactggattattcaagcct
cagttgtcaggaaattctcctgctggcactttatttaggtgggaagaggatgaaatacca
agttctctactgctggaaggtgtggagcccctgagtacctgtgagttagaagtggacgcc
gtagctgctgacatcttgaataggctggatattgaggctcaaattggtggaaaccctggg
ctgcaggccatatgggaagatgaaaaacagcgacgaagaaacaggaatgaaaactctcaa
attagccagccagaatcacaagattgcagactcgtgccagcaacagaaagtgaaaaaatt
tttcagaagagacttcaagaaattctcaaacagaatgatttctcagtaacactatcagga
tctgtggactacagcagtgggtcccaggagttctctgctgagttaacattgcactctgag
attctgtctcctgaaatgcttccctgttcaccggccaacatgatagaagtccacagagac
aacgattggagcaaaggtaacactaaacataaagtagaagaagcactcattaatgaagaa
gcaattttgaacctcatagaaaatagtcagacttttcagcctttgactcaaagactgagt
gagacaccggttttcatggacagtagtcctgacgagtcgctggtccatcttcttgctggt
ttggaaagtgatggataccaaggagaaaagaataggatgccattacctcgtcacacgttt
ggggaatctcaaaacccccaaaacagtgacgatgaagagaatgcgccccagatggagaag
gaagagatggagcttagtgtgctgatgtcccagagatgggacagcgatactgaagaacag
tgtgccaaaaagaggtccctgtgcagaaatgcccacagaagttctactgaagaagatgac
tcgtcctctgaggaggaaatggagtggactgataatagtttgctttttgccaatctctct
atacctcagttagatggaactgcagatgaaaatagtgacaatccattgaacaatgaaaat
tctagagcccactcttctgtgatcgcaacaagcaagctgtcagtaaggccctccgtcttt
cacaaagatgctgctacattagaacctccgtcttctgctaagattaccttccagtgtaaa
cacacaagtgccctttcttcccatggtttaaacaaagatgacttaattgaaggcctctca
cagccaaacaatacagaaaaaggtcgagatagttcagtcacttttacaaaggaaagtact
tactccatgaaatactctggctctttaagtagtactgttcattcagataattctcataaa
gagatttgtaagaaagacaagtctttgccggtaccttcctgtgaaagcagtgtttttgat
tatgaagaagatattccatctgttacaagacaagcaccaagtagaaagtactcgaacatg
aggaagatcgagaaggatgcccctttcatacatgctaaccgtcacactagtgagagtaca
ctggggaaaaactctttcaactttgctgacttaaatcattcaaaaaataaattgtcctct
gaaggaaacgagaggggaaacagcacagctctcaatagtgtctttccctcgtcactagct
gagagctgtgacttgttgtcgtcctcaggggagaatagaagtgtggctcattccctcgat
agcatcactgatgagagtggacgaagtaaacttaaaatcagatacgaagagtttcaagag
cataaaatggagaggccaagcctcagccagcaggcagcacattatatgtttttccccagt
gtcgttctttctaattgtctcaccaggccacagaaactgtctcctgtcacctacaaacta
caacctggcagtaaaacatcccggttaaaattgaataaaaagaaattgataagtcttcag
gaaacttctaccaaaagtagtgaaaccggagccgcaaaagacagttgtacacataatcat
ccgtacagcggtactcctgagaaggagagtgggttgagcagtgacttaattaaagccact
catgggacatttgaaaataaaacacctacagaacactttatagactgtcattttggagat
ggatctttagaaactgaacagtcttttggactatatggaaataaatatactcttagagcc
aaacgcaaggtgaattatgaaacagaagacagtgagtcaagttttgtaacacacaactcg
aaaattagcctacctcatcccatggaaattggtgaaaacttagatggaactctcaaatcc
cgaaaacgaagaaaaatgtctaaaaagctgccccctgtcattataaagtatattattatt
aatagatttagagggaggaaaaatatgcttgtgaagctaggtaaaatagattctaaagaa
aaacaagtaatattaactgaggaaaaaatggaactttataaaaagcttgcacctttgaag
gatttctggccaaaagttcctgactcccccgcaaccaaataccccatttatccactaaca
ccaaagaaaagtcacagaaggaagtccaaacataagtctgctaagaggaagcctggtaag
cagcacagagcaagcagtgaaaacattaaaagaacgttatctttcagaaagaaacggaca
cacgctgttctttctcctccttccccatcgtacattgctgaaaccgaagactgtgacttg
aattatagtgatgttatgtcgaagctaggctttctttctgagagaagcacaagccctgtc
aattcttctccgcctcgatgctggtctcccacagaccccagagccgaagaaataatggct
gctgcagaaaaggaatcagtgctttttaagggtcctaatgtatgtaatactaagaccgtg
agtcctcgagtgggaaaagctagtcgagcaagagcacaggttaagaagtcaaaagcaaga
ctcgctaagtcctctgtagtcactaacaaaagaaacaagcggaatcagacaaatcaacta
gtagacaatgggaaaaagaaaccaagggcaaagcagaagcagagagccaatgagaagggt
atatcaaggaagcctgtaatacccacggacgagactacgaagcctccgtctgaggccgag
ctcacaccgagccagcggagcgtgcctgagcttacgagtagttctggcattcacacactt
tccaaacagaaagagatgacacagaccggtcctgccatggatcatccacttcctccttgc
cagcccactgggattaatgctcaacagcggctgtccaactgcttttcctctttcttagaa
agcaggaagtctgtacagtttccaacattccccagttcaagaggtgattcccgttcctct
gtttatagttctatagggcctggagtctcaaaagttaatactcagagatctcatagtcaa
agtgctatgtttactcgaaaggaaacaaccttgattcagaaaagcatatttgacctttct
aaccatttgtctcaggtagcacagagcacgcagttatgttcaggtataatatctccaaag
acagaggagagttcaaatacacaaaagaactgtgggtcatctattggaaagttaaatgag
tatcgcagttccctagagtcaaagccagagaaagtctgtgcccctaattttttgcactgc
agagacagtcagcagcagactgtgaatgtgtcagaacagtcaaaacccagtgaaacctgt
tctccgggaaatgcagcttctgaggagagccagacacctaactgttttgtaacttctttg
agaagtcccatcaaacaaataacatgggagcagagacagaggggctgtattttagagatg
tcaagttttaagcctgaaaaggtaaaacagaggtcattgtcagaagcaatttcacaaacc
aaagcactatctcaatgtaaaaatcaaaatgtgtcaacaccttcagtatttggtgaagga
cagtctgggttagctgttctaaaagaattgttacaaaaaagacagcagaaagcacaaacc
acaaatgtacaagattcggcatctagtcatcagccagataaggatatttctgtttctgct
gagcacaagaagacaaataaacggacacgagcagtagcatctccaaggaaacctcgagct
cccaggagaacaaagcctaaggaacaaacccccagacgtctgaaagtggaccctctaaac
ctgcagacctctggccacttggataactccctgtcagatgacagtcccatccttttctca
gatccaggcttcgaaagttgttactcacttgaagacagcctgtctcctgaacataattat
aattttgatattaacacaattggtcagactgggttttgcagcttgtactctggcagtcag
tttgttccagctgaccagaatttgccccagaagtttctaagcgacgccgttcaggatctg
ttcccaggacaggctatagaaaagaacgagcttttaagtcatgacagacagagttgtact
gaggaaaagcatcacgtctctgactcaggcccatgggttagagccagtactttgaaccct
gaactttttgagaaagtaggtatagataacaatgagaatcatcggcacagccaatggaaa
actagctttcaccctctgacctctcactctaactcaataatggagtctttctgtgtccag
caagcagaaagctgtctacctgaaaaatcgagactgaataggagttcggtgagtaaggaa
gtgtttctcagtctcccgcaggcaagcagttcagactggattcaaggtcataacggaaaa
gaaatagaacagtcccttgactcagctaatacctctttcactaccgtactttcctcccct
gatggggaacttgtggatgcagcttctgaagatttagaattgtacgtctcaagaaacaac
gacgtgctgacaccaacccctgatagttcaccccggtctaccagttctcccttacaatct
aagaacggcagttttactcctcgaactgctcacattctgaaaccgcttatgtctccacca
agtagggaagaaatcgtggcaactttgctagaccatgatctttcagaagctatatatcag
gaaccattttgcagtaatccttcggatgtgccagagaagcccagggagattggtggacgg
ctcctaatggtggaaactcggctccccaatgacctgattgaatttgaaggagacttctcc
ttggaaggacttcgcctatggaaaacagcgttctcagcaatgacgcagaatcccagacca
gggtccccacttcgtaatggcccagcagttgtcaataaagagtcgagcaatagccataag
acggtggaagataaaaaaattgtaattatgccttgcagatatgccccaagtaggcagctg
gttcaggcatggcttcaggccaaagaagagtatgtgcgttcaaagagactccctagaacg
gagtcaactccagtgataaagtccgctgacaacgtcagcccttcacttaatccgggtgac
acccgtgcagtggctccacaaatggatacatgcccacacacactgtcctctacagcacat
gccaaggaggaagtctgtcagtctcagattgctttgcagacatcaaggacaggttgtggt
cagacagtaagtgccagtcagacactgctaccagctgcctctgcagccgttcctgaggag
gaggaggaggaggaggaggaggaggaggaggaggaggaagatgagaacggttacgtgagt
tacagctcccctgattctccaggcattccaccttggcaacaagcagcatccccagatttc
agagcactaaacggagagcatcgatgttcgtcaccggtcgaggagctttgttcccgagct
gttgagaacttcttaaagcccatcaaagatggtatccaaaaagcctcctgttgtgagtct
caagtaatctctccaatccatgctaggacaagaactgagaaatgtgagcctctttgcctt
catagtacaccagttatgccgagaaaatttctggaaaagcttcctgaagcaactggcctt
agccctttatccgtagaaccaaaaacccagaagttgtacaataagaagggaagtgacact
gaccatcttcggagagttctcctgacaacacaagtggagaatcagtttgcagcagtaaat
actccaaagaaagaaacttctcagattgatgggccgtccttaaacaacacctatggtttc
aaagtcagcatacagaacttacaagaggcaaaggctttacacgagatacaaaatcttacc
ttaatcagtgtggagttacacgcacgaactagaagagacttacaacctgatcctgagttt
gacccaatctgtgctttgttctactgcatttcatctgacactccactcccagacacagaa
aaaacagaactgaccggtgtaatagtgattgataaagacaagacagtcacccatcaagat
atcagatgtcagaccccattacttatcagatctggagtcacaggattagaagtgacctat
gctgctgatgagaaggctctctttcaagaagttacgaatataatgaagaggtatgaccct
gacattctactaggctatgagattcagatgcactcctggggctacctcttgcagagggcg
gctgctctgagtgtggatttatgtcagatgatctctcgagtgccagatgacaaaattgaa
aacagattcgcagcggaaagagatgactacgggtcagatacaatgagcgagataaatatt
gttggaagaattacgctgaacctttggagaatcatgagaaatgaggttgctctgactaac
tacacttttgaaaatgtgagctttcatgttctgcatcagcgtttccccctttttaccttc
cgagtcttgtcagactggtttgataacaagacagatctctacagatggaaaatggtcgat
cattatgttagccgtgtccgtggaaatctccagatgttagaacagctggacctaattgga
aaaaccagtgaaatggccagactttttggcattcagtttttacatgtattaacaagaggg
tcacagtaccgtgtggagtcgatgatgttacgtattgctaaaccaatgaactatatccct
gtgacacctagtgttcaacagagatcccaaatgagagctccacagtgtgtgcccctcatt
atggaacctgaatctcgtttctatagcaactctgtgcttgtcttggatttccagtcccta
tatccttcaattgtgattgcatataactactgtttttccacttgccttggccatatagag
aatttgggaaagtatgatgagttcaaatttggctgtacctctctaagagtacctccagat
ttactttaccaaattaggcatgacatcacagtgtcccccaatggagtagctttcgtcaag
ccttctgtacgaaagggtgttctaccaagaatgcttgaagaaattttgaagactagattc
atggtgaagcagtcaatgaaggcttataggcaagaccgagccctgtcacgaatgctcaac
gcccggcagctaggactcaagctaatagcaaacgtcacgtttggctatacgtctgctaac
ttctcggggaggatgccgtgcatcgaggttggcgatagcattgttcacaaagccagagag
accctggaacgagcaattaaactagtgaacgataccaagaaatggggcgccagggttgtt
tatggtgatactgacagtatgtttgtactactgaaaggagccaccaaggagcagtctttt
aagattggtcaggaaattgctgaagccgttactgcgactaatcctaagccagtgaaactg
aagtttgaaaaggtatatttgccttgtgttttgcaaacaaaaaagagatatgtgggttac
atgtatgaaacactggatcagaaggacccagtgtttgacgcaaaaggaatagaaacagtg
agaagagactcttgccccgctgtttccaagatacttgagcgttctctaaagctgctgttt
gaaaccagagatatcagcctaattaaacagtacgtacagcgacaatgtatgaaacttgtg
gaaggaaaggccagcatacaagattttatctttgccaaggagtaccgaggaagtttttct
tacaggcctggagcctgtgtcccagcccttgagcttacaaggaaaatgcttgcttatgac
cggcgctctgagcctcgagttggagaacgagtgccgtacgtcattgtttatgggacccct
ggactaccccttatccagttgataaggcgcccagcagaagtcttacaagatccgactctg
agactgaatgccacttactatatcaccaagcaaattcttccaccgctggcaagaatcttc
tctcttattgggattgatgtcttcagctggtatcaagaattaccaaggatccagaaagcc
accagctcttccagaagtgaccttgaggggcggaaaggcacgatctcacagtacttcact
accctgcactgtcctgtgtgtgacggcctgactcagcacggcatctgcagtcagtgtcgg
agccagcctcagcatgtagccatcatcctcaaccaggaaattcgagaactggagcgccaa
caggagcagcttgtgaagatatgcaggaactgtacgggttccttcgaccgacatatccct
tgtgtttctctcaactgcccagtacttttcaaactctcacgagtaaacagagaattatcc
aaggcaccgtacctgcggcagttactggaccagttctag

DBGET integrated database retrieval system