KEGG   Rattus norvegicus (rat): 312272Help
Entry
312272            CDS       T01003                                 

Gene name
Mgam
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    312272 (Mgam)
   00500 Starch and sucrose metabolism
    312272 (Mgam)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    312272 (Mgam)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     312272 (Mgam)
    3.2.1.20  alpha-glucosidase
     312272 (Mgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 312272
NCBI-ProteinID: XP_008761090
RGD: 1308368
LinkDB All DBs
Position
4q23
AA seq 1980 aa AA seqDB search
MARKLSVLEVLLIIFNVIVLAVDILLLLLLLESPPGKGDGAFTPECPDISESERIDCAPG
QVVTEDACRWQRKCCWKPVADPKVPACFFPRNWGYEVTSVPTNTSTGLTAKLKKLSSPSL
FGNDIADALLTAEYQTSSRFHFKITDFNEIRYEVPYENINLVNGTAENSSLSYDIEVIKK
PFSIRVLRKSNQRVLLDTGIGPLQFDQQYLQLSFRLPSSNVYGLGEHVHQQYLHNMSWNT
WPIFTRDTTPRQGMINLYGAHTFFLCLEDTSGASFGVFLMNSNAMEVTLQPAPAITYRTT
GGILDFYIFLGNTPEQVVQEYLEVVGRPFLPSYWSLGFQLSRRDYGGIDGLRQVVQRNRD
AEIPYDVQYSDIDYMNGSRDFTIDEQAYPQLSDFAKDLHDNGQKYVIILNPGIISNTNDE
VYFNGSKNRVWIMSSRGFATGEGYAGESVFPDFTNPASLPWWTQQVTEFYNRLEFDGVWI
EMDELATLPPAPKCELNNLNHPPFTPSVLDGSLSVGTLCMDTEFYSGLHYDVHSLYGYTM
AKATNLALDAVFSSKRNFLLSRSTFAGSGKFAGHWLGNNAASWDDLRWSIPSILEFNLFG
IPLVGANICGYENNVTEELCTRWMQLGAFYPLSRNHNGPEYRDQDPAAFGPNSLLLQSSR
HYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWAVHEQFLWGPGLLITPVL
YEGKEEAKAYIPDAIWYDYETGLAVQWRKQFIDMPLPRDRIGLHLRGGYIFPIQEPNITT
EASRKNPLGLIVALDYKREAKGQLYWDDGVSKGTVSEKNYLLYDFSVTSNHLQAKIINGN
YVDPNNIMFTDIRILGMDKEPTDCNVLFNGNKISTSTCNYNASAKVLIISNLTGLKLGQE
FSIEWKLVVNDLEKFNCFPEDPAVSEERCKQRGCLWEQTTAPGVPICFYDTIPQYAASNI
QYQPTGITMDLTLLENSTSAQAAAAPRVVSDPLSGKINSLRLSVTYHTENMLQVKIYSTS
NKRYEVPVPLNIPSSPLGYSENCLYDVSVKTNPFGLQIQRKSSGTVIWDTQLPGFTFSEM
FLSISTRLPSHYIYGFGETDHTSLRRNMSWNTWGMFARDEPPLYKKNSYGVHPYYMALED
NSNAHGVLLLNSNAMDVTLQPTPALTYRTIGGILDFYMVLGPTPELVTQQYTQLIGRPAM
PPYWALGFQLSRYGYQSDAEIGNLYSAMVAARIPYDVQHVDIDYMDRKLDFTLSPNFQNL
SVLINQMKTNGMRFILVLDPAISGNETHYLTFTRGQENNVFIKWPDSNDIVWGKVWPELP
NVNVDGSLDLETQLKLYRAYVAFPDFLRSSTASWWKKEIEELYSNPREPQKSLKFDGLRI
DMNEPSNFVDGAVGGCRSEILNNPPYMPDLEARNVGLSSKTLCMESEQILPDGSRVQHYD
VHSLYGWSQTRPTYEAMQEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLRKSIIG
MMEFSLFGIPYTGADICGFFGDAEYEMCIRWMQLGAFYPFSRNHNTAGTRRQDPVSWNST
FEGYARNVLLIRYALLPYLYTLMHKAHTEGSTVIRPLLYEFTDDNTTWDIDHQFMLGPAI
LISPVLESDTFEIRAYFPRARWYKLLTGSGNNSAGEWKTLEAPLDHINLHIRGGYILPWQ
VPGMNTYFSRRNFMGLTVALDNDGKAEGQLFWDDGQSIDTYEKGNYFLATFIAEMNTLEN
PDLHNQYLSDTIHXKSDSLEYLGFNYTYVVQVICTXTTKQFIENNFYSDPYNQYELFIQL
DAWNMTLEKLSKVIWVYGHPTLPTPNATSAFPASSFPPGFSTETVTSPALTTTSEVTTTF
ITLLPNTTTSLPTQPPSTNTSNVMPVTTTSTETSPVASTTSTTFPGITTLFPTTSYTNTS
DIYPETISTPDTSPVVSTTNTTFPDITTPFPTTSSHTNTSDEVSMGFATHLWTRLYSAYV
NT seq 5943 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcagtgttttggaagtcctcctgatcatttttaatgtgattgtactg
gcagtagatatacttttgctgcttctcttgctggagagcccaccaggtaagggtgatggt
gcgtttactcctgaatgtccagacatctctgagtcagaaaggatagactgtgcacctggc
caggtggtgacagaggacgcctgtcgatggcagcgtaaatgctgctggaagccagtggca
gatcccaaagtccctgcatgcttcttccctaggaactggggttatgaagtcaccagtgtc
cctacaaatacgagcacagggttaactgccaagttgaagaaattgtcatccccatctctt
tttggaaatgatattgctgatgccttattgacagctgaataccaaacatccagtcgtttt
cattttaagatcactgatttcaatgagatacgatatgaagtcccttatgaaaacatcaac
ctcgtaaatgggactgctgagaattccagtttgagctatgacatagaggtcatcaagaag
ccattcagcatccgagtactacggaagagcaaccaaagagtcttgctggatactggcatt
gggccgctccaattcgaccagcagtacctgcagctctctttccgactgcccagctctaac
gtgtatggactcggggaacacgtgcatcagcaatacctccataacatgagctggaacacc
tggcccatctttaccagagacaccactcccaggcagggcatgattaatctttatggagca
cacacattcttcttgtgcctggaagataccagtggggcttcttttggagtatttctgatg
aacagcaatgccatggaggtcacacttcagcctgctcctgccattacttaccgcacaact
gggggaattcttgacttttacatcttcttgggaaacacgccagagcaagtcgttcaggag
tacctggaggttgttggtcgaccattcttgccttcttattggagccttggttttcagctc
agccgcagggattatggtggcattgatgggctgagacaggttgtacagcgaaaccgtgat
gctgagatcccatatgatgtgcaatactcggacatagactacatgaatggaagtagagat
ttcactattgatgaacaggcttacccccagctctcagattttgcaaaggacctacatgat
aatggacagaaatatgtaattattctgaatcctggcatcatcagcaatactaatgacgag
gtctacttcaatggaagcaagaacagagtctggatcatgagctccagaggctttgctact
ggggagggttatgcaggagagtcagtctttcccgactttaccaatccagcctctcttcca
tggtggacccagcaggtcactgaattttacaaccgtctggagtttgatggtgtgtggatt
gaaatggatgaactagccacgctccccccagctcccaagtgcgagttaaataacttgaac
caccctcccttcactcccagcgtcctggatggctctctgtcggtaggaaccctctgcatg
gacacagaattttactcaggccttcactacgatgtccatagcctatatggctacaccatg
gcaaaagccacaaacttggccctggatgctgtcttctcttccaagaggaacttcctttta
tcacgttctacttttgctgggtctggcaagtttgctggtcattggctgggaaacaatgca
gccagctgggatgatctcagatggtctatccccagtatccttgagtttaatctatttggc
atccccctggtaggagccaacatctgtggctatgaaaacaatgtcacagaagaactttgc
acaaggtggatgcaacttggagcattttacccactatccaggaatcacaatggtcctgag
tacagagaccaggaccctgctgcctttggccctaactctctgctattgcaatcatcgaga
cattatttgaacatccgctataccttactgccgtatctctacactctcttctaccgagct
catactctgggagagaccgtagcaagacccctggtacatgaattctatcaggacccagcc
acatgggctgtacatgagcagttcttatgggggcccggactcctcatcactcctgtgttg
tatgaaggcaaggaggaagcgaaagcctatatcccagatgccatctggtatgactatgag
acgggactggctgtccaatggagaaaacaatttatagacatgccactaccacgtgacagg
ataggacttcaccttcgaggtggctacatatttcccattcaagaaccaaacataaccaca
gaggccagccggaagaatcccttgggactcatcgttgccttggattataagcgagaagca
aagggccaactgtactgggatgatggtgtgtctaaaggcacagtgtctgaaaagaattac
cttctctatgatttttctgttacatctaatcatttacaggcaaaaattataaatggtaac
tatgtggatcccaataacatcatgttcacagacatcagaatcttagggatggacaaagaa
ccaactgattgtaatgttttatttaatggcaataagatctctacttcaacctgcaactac
aatgcttccgcaaaggtgttgatcattagtaacctcacgggactgaaactgggacaggaa
ttttccattgagtggaagcttgtagtcaatgacctggagaaatttaactgcttccctgag
gatcctgccgtatcagaggaaaggtgcaagcagcgagggtgcctctgggagcaaacaact
gctcctggagtgcctatctgtttctatgacaccattccccagtatgctgccagtaatatt
cagtaccagcccacaggcattaccatggacctgaccctcctggaaaactcaacatctgcc
caggcagcagcagctccaagagttgtctctgatcctctttctggaaagatcaactctctt
agactgagtgtgacttaccatacagaaaatatgctgcaggtcaagatttacagtaccagt
aacaaaaggtatgaagtcccagtacctctgaacattccttcttcaccactgggctactct
gagaactgcctgtatgatgtaagtgttaagaccaacccatttggactccaaattcaacgt
aaaagctccggtactgtgatttgggatactcagctccctggcttcaccttcagtgagatg
ttcctttccatttcaactcgtcttccctctcattacatctatggctttggggaaacagac
catacatctttgagaagaaatatgagttggaacacatggggaatgtttgctcgggatgag
ccaccattgtacaagaaaaattcctatggtgttcacccttattatatggcattggaagat
aatagtaatgctcatggagtgctcctgttgaacagcaatgccatggatgttacactccag
cccacccctgccctgacataccgcaccataggagggattctggacttctatatggttttg
gggccaacacctgaacttgtaactcagcagtacacccagttgattggtcggccagccatg
cctccatactgggccttaggtttccagctgagtcgctatggataccagagtgatgctgaa
attggcaatttgtattctgcaatggttgcagcaagaattccttatgatgtgcagcatgta
gacattgattacatggaccggaagttggacttcaccctcagccccaactttcaaaatctc
agtgtcctgattaatcaaatgaagacaaatggcatgagatttattctcgttctggatcca
gctatttctggcaatgagacacactatctcacattcactcgaggacaggaaaacaatgtg
ttcatcaaatggcctgattccaatgacatcgtctggggcaaggtgtggccagagttgccc
aatgtaaatgtggatggatcccttgacctcgagactcaacttaagctatacagggcctat
gttgcttttcctgacttcctgcgtagcagcacagcctcatggtggaagaaggagatagaa
gagctctattcaaatcctcgggagccacagaagagtttgaagtttgatgggctgcggatt
gatatgaatgagccttcaaactttgtggatggagctgttgggggctgccgcagtgagatt
ctcaataatccaccctacatgcccgatttggaagccaggaatgtgggcttgagcagcaag
actttatgcatggaaagcgagcagatccttccagatggctcccgggtgcagcactatgat
gtgcacagtctatatgggtggtctcagaccagacccacctacgaagctatgcaggaggtg
acaggagagagagggatcgtcatcacccgctccacattcccctcttctggacgctgggga
ggacactggctgggagacaacacagctgcctgggaccagctgcggaaatccatcattggt
atgatggagttcagtctgtttggaataccttatacaggagcagatatttgtgggttcttt
ggagatgctgagtatgagatgtgtatccgctggatgcaactgggagccttttatccattt
tccaggaaccacaacacagctggaactaggagacaagaccctgtgtcctggaattcaact
tttgaaggctacgcaagaaacgtgttgcttatcagatatgccctgctgccatatctgtat
actctgatgcacaaagctcacacagagggcagcactgtcatccgaccacttctctatgag
ttcacagacgacaatacaacatgggatatagaccaccagttcatgctgggcccagccatc
ctgatcagccctgttctggaaagtgatacatttgagatccgtgcttatttccctagagcc
cgttggtataaacttcttacgggatctggcaacaattcagcaggtgagtggaaaacactt
gaggctcctctggaccacatcaatcttcacatcagaggaggctacatcctgccttggcaa
gtgcctggaatgaacacttacttcagtcggcgaaattttatgggattgactgttgctttg
gataatgatgggaaggccgaaggtcaattgttttgggatgatggacaaagcatcgataca
tatgaaaaaggaaactatttcttggctacctttatagcagaaatgaacaccttggaaaat
ccagatctgcataatcagtatctgagtgacacaatccactgaaaatcggattcattagaa
tatcttgggtttaattatacttatgtggtgcaagttatttgtacataaacaaccaagcaa
ttcatcgagaataatttctatagtgatccctacaatcagtatgaactatttattcaattg
gatgcatggaatatgaccctagaaaaactgagtaaagttatttgggtttatggacatcct
acacttcccacaccaaatgcaaccagtgcatttcccgcaagctctttcccacctggattt
agcactgaaactgtgaccagtcctgctctcacaaccacatctgaagtaacaactactttc
ataaccctacttcctaatacaactacatctctccctacacaacctccttccactaacact
agcaatgtgatgcctgtcacaactacatctactgagacaagtcctgttgccagtacaact
agcaccacatttccgggcataactacacttttccctacaacttcttatactaacactagt
gatatatatcctgaaacaatttcaacccctgatacaagtcctgttgtcagtacaactaat
accacatttcctgacataactacacctttccctacaacttcttctcatactaacactagt
gatgaagtctccatgggctttgccacccacctctggacccggctgtattcagcctatgtg
taa

DBGET integrated database retrieval system