KEGG   Rattus norvegicus (rat): 313610Help
Entry
313610            CDS       T01003                                 

Gene name
Extl1
Definition
(RefSeq) exostosin-like glycosyltransferase 1
  KO
K02368  alpha-1,4-N-acetylglucosaminyltransferase EXTL1 [EC:2.4.1.224]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
rno01100  Metabolic pathways
Module
rno_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    313610 (Extl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    313610 (Extl1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.224  glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
     313610 (Extl1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   313610 (Extl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_64 Exostosin Methyltrn_RNA_3
Motif
Other DBs
NCBI-GeneID: 313610
NCBI-ProteinID: NP_001101455
RGD: 1309572
Ensembl: ENSRNOG00000016776
UniProt: D3ZLU1
LinkDB All DBs
Position
5q36
AA seq 670 aa AA seqDB search
MLWRRKSFWLALSAFWLLLILLGVFPLRLAVSPRPLPGRSQGWPRWLDATFLQSFSQPET
NPEEDVQQLPRVSRGSSCTWGACFDTSKCRGKVLKIFVHSAAGPTTEAQRRILDSLEGSR
YYALSPAEACLLLFLPSQDRRGACGPLPPNWNGGRNHLVLSLYPAPCTRLGQAMVAEASP
SLDIFRPGFDVALPYLPEAHPLKGGAPGSLQRHGPQPGATLVAVAEERGRWRITTTHASA
CPWDRNCEQDPGPQQTYPGEILPNVTFCLIPGHRSATSCFLQALQAGCIPVLLSPRWELP
FSEVIDWTKAAIVADERLPLQVLAALREMLPSRVLALRQQTQFLWTAYFSSVEKVVHTTL
EIIQDRIWGASAHPSLMWNSPPGALLALPTFSTSLQDFPFYHLQLGSSPGSSFSAVIWVG
VSEESPPKLIQEVAGSRHCAQILILWNSEKPPPDRWPKTAVPLTVIEGHRKVSDRFFLYS
NISTNVILSLDAQSTLSTSEVDFAFVVWQSFPERMVGFVTWSHFWDEARQGWGYSAEMAN
EFSMVLTTAAFYHRYYHTLFTHSLPKALRSIADETPTCVDILMNFLVATVTKLPPIKVPY
SRQHQEAAPMASEGPRPVPEPQALDQDCINRLAAGLGHMPLVSSRVRLDPVLFKDPVSVQ
RKKYRSLEKP
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggagaagaaagtccttctggctggcattgtcagccttctggctcctcctcatc
ctcctaggagtcttcccccttcgcctggcagtgtctccccgtcctcttccagggcgctcc
caaggttggccccgctggctggatgctaccttcctacagagtttctcccagcctgagacg
aaccccgaagaagatgttcaacagctccctcgagtctcccgggggagcagctgcacctgg
ggagcctgctttgacacctccaaatgtagggggaaagtcctcaagatctttgtacactcc
gcggctggtccgaccactgaggctcagcgcaggatcctggactccttggagggctcccgc
tactatgcactcagcccagcggaggcttgccttctcctctttctccccagccaggaccgt
agaggagcatgcgggcccctgcctccgaactggaacggaggccggaaccatctggtgctc
agtctctacccagccccttgcaccaggctgggacaggcgatggtagctgaggctagcccc
tccttggacatcttccgaccaggcttcgatgtagcgctcccgtatctccctgaagctcac
ccattgaaaggcggggcccctggcagcctgcagcggcacggtccccagcctggggccacc
ttagtggcggtagcagaggagaggggcaggtggcgtattacaaccacccacgcctcagcc
tgcccctgggacaggaactgtgaacaagatcctggaccccaacagacctacccaggagag
atacttcccaatgtcaccttctgcctcattcctggccaccgatctgctacctcctgcttt
ctccaagcccttcaggctggctgcatccctgtgctcctcagcccccgctgggagctgcct
ttctctgaagtcatcgactggaccaaagcagccatcgttgcggatgagaggctcccactg
caggttctggctgcgctccgtgaaatgctcccttcgcgggttctcgccctgcgccagcag
acccagtttctgtggaccgcttacttctcctcagtggaaaaagtcgttcataccacccta
gagatcattcaggaccggatctggggtgcatcagctcacccctcactgatgtggaatagc
cccccgggggcactcctggctctgcccactttttccacgagccttcaagacttccccttt
tatcatctgcaactgggctccagccctgggagcagtttcagcgccgtgatctgggtgggc
gtctccgaagagtccccgccgaagctcatccaggaagtggcaggttcccggcactgtgcc
cagatcctgatcctctggaacagtgagaagccaccccctgataggtggcccaagacagca
gtgcccctaacagtcattgagggacacaggaaggtcagcgaccgtttcttcctgtacagc
aacatcagcaccaatgtcatcctcagccttgatgctcagagcactctttctaccagtgag
gtggactttgcctttgtggtgtggcagagttttcctgagcggatggtgggctttgtgacg
tggagccacttctgggatgaggcccggcagggctggggctacagtgctgagatggccaat
gaattctccatggtcctgaccaccgcggctttctaccacagatactaccacaccctcttc
actcactccctgcctaaagccctgaggagcatagccgatgagactcccacctgtgttgac
atcctgatgaacttcctggtagcaaccgtcaccaaactgccccctatcaaggtgccttac
agcaggcagcaccaggaggctgcaccaatggcttctgagggtccaagacccgtgccggag
cctcaggccctggatcaggactgcatcaaccgtttagcagcagggctgggccacatgcct
ctggtttcctctcgagtgcgtctggatccggtgctgttcaaggacccggtatcagtgcaa
cgcaagaagtatcgcagtttagagaaaccctag

DBGET integrated database retrieval system