KEGG   Rattus norvegicus (rat): 361688Help
Entry
361688            CDS       T01003                                 

Gene name
Kmt5b, Suv420h1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    361688 (Kmt5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    361688 (Kmt5b)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     361688 (Kmt5b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     361688 (Kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 361688
NCBI-ProteinID: NP_001101982
RGD: 1311637
Ensembl: ENSRNOG00000016790
UniProt: P0C2N5
LinkDB All DBs
Position
1q43
AA seq 883 aa AA seqDB search
MKWLGDSKNMVVNGRRNGSKLSNDHQQNQSKLQHAGKDALKTGRNAVERRPNRCHGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHISKADSFS
HNNPMRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKSSDSQSVSSNTDADTTQEKDNATSNRKSSVGVKKNSKSRALTRQSMPRVPA
ASNSTSPKLVHMNNSRVPKKLRKPAKPLLSKIKLRNHCKRLDQKSTSRKLEMGNLVLKEP
KVVLYKNLPIKKEREAEGPVHAAVGSGCLTRHAAREHRQNPGRGAHSQGDSLPCTYTTRR
SLRTRTGLKETTDIKLAPSPLDGYKNGILEPYPDSGQQPTPEVLEELAPETALREEASQE
CPKSDSCPSRKKFRQGKPVKHLAKTEDCSPEHSFPGKDGLPDLPGPHPDQGEPSGTVRVP
VSYTDSAPSPVGCSIVTPDSFTTKDSFRTAQSKKKRRVTRYDAQLILENSSGIPKLTLRR
RHDSSSKTNDHESDSVNSSKISIKLSKDHESDSNLYVAKLSNGVSSGPGSSSTKLKIQLK
RDEESRGPCAEGLHENGVCCSDPLSLLESQMEVDDYSQYEEDSTDDSSSSEGEEEEEDCE
DDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagactccaagaacatggtggtgaatggcaggagaaatggaagcaag
ttgtctaatgaccatcagcagaatcaatccaaattacagcacgcgggcaaggacgccctg
aagactggcagaaacgctgttgagaggcggcccaacagatgtcatggtaactcgggattt
gaagggcagagtcgctatgtgccatcctctggaatgtccgccaaggagctctgtgagaac
gatgacttagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aacactagcgcctttccttcgaggagctcgagacatatttccaaagctgacagtttttct
cacaacaaccctatgagatttcgacctataaaaggaaggcaggaagagctaaaggaagta
attgaacgctttaagaaagatgaacacttagagaaagcttttaaatgtttgacttcaggt
gaatgggcacgacattattttctcaacaaaaacaaaatgcaggagaaattattcaaagaa
catgtctttatttacttgcggatgtttgcaactgacagtggatttgaaatattgccttgt
aatagatactcttcagaacaaaatggagccaagatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacacggagaaaacgacttcagtgtcatgtattccacaaggaaaaattgt
gctcaactctggctcggtcctgctgcatttataaatcatgattgcagacctaactgtaag
tttgtgtcaactggccgagatacagcatgtgttaaggctctgagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaataatgagttctgcgaa
tgttacacttgcgaaagacggggaactggtgcttttaaatcacgagtaggactgcctgcg
cctgctcctgttatcaatagcaaatacggacttagagaaacagataaacgcttaaatagg
cttaaaaagttaggtgacagcagcaaaagctcagacagtcagtctgtcagctctaataca
gacgcagacaccactcaggaaaaagacaatgcaacttctaaccgaaagtcttcagttggt
gtgaaaaagaacagcaagagcagagcactgacgaggcagtccatgccaagagtcccagcg
gcttccaactctacctcacctaagctagtgcacatgaacaattccagggtaccaaagaaa
ctgagaaagccggcgaagcctttactttccaagatcaaactgaggaatcactgcaagcgg
ctggaccagaagagcacatcccggaagctcgagatggggaacttagtgcttaaggagccc
aaagttgtgctatataaaaatttgccaattaagaaagagagggaggcagagggaccagtc
catgctgcagtggggagtgggtgcttgactagacatgctgcgagagaacacaggcagaac
cctgggagaggtgctcactcgcagggcgacagtttgccctgcacctacacaacccggcgc
tctttgaggacaaggacaggtctgaaggagaccactgacatcaagcttgcaccaagtccc
ttggatggctataaaaatggtatactggaaccttacccagacagtggccagcagccaacc
ccagaggtgctggaagaactggctcctgagactgctctcagggaggaagcatcccaggag
tgtcccaagagtgactcctgcccttcacgaaagaaatttcgacaagggaaacccgtgaaa
cacttagcaaagacagaggattgcagtccagagcacagcttccctgggaaagacgggctg
ccagatttgccagggccccatcccgaccagggtgagcccagtggcacggtcagggtgcct
gtgagctacacagactctgctccctcacctgttggctgctccattgtcacacccgacagc
ttcacaacaaaagacagcttcagaactgcacaaagtaaaaagaagcggcgggtcaccagg
tacgatgcacagctgatcctagagaacagctctggaatccccaagttgacgcttcgcagg
cggcatgacagcagcagcaagacaaatgaccatgagagtgatagtgtaaactcctcaaaa
atcagcatcaagctcagcaaagaccatgaaagtgacagtaacctctatgttgcaaagctt
agcaatggggttagctcggggccaggcagcagctctactaagctcaagattcaactcaag
cgggatgaggagagcagggggccatgtgcagaagggcttcatgagaacggtgtgtgctgc
agtgaccccctgtccctgctagagtcccagatggaggtggatgactatagtcagtatgag
gaggacagcacagatgactcgtcatcttctgagggggaggaggaagaggaggactgtgag
gatgacttcgatgatgacttcatccctcttcctcccgcaaagcggctgaggctaattgtt
ggtaaagactccatagatatcgacatttcttcaaggagaagagaagatcagtctctaaga
ctgaacgcatga

DBGET integrated database retrieval system