KEGG   Rattus norvegicus (rat): 362356
Entry
362356            CDS       T01003                                 

Gene name
Cul1
Definition
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04350  TGF-beta signaling pathway
rno04710  Circadian rhythm
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    362356 (Cul1)
   04120 Ubiquitin mediated proteolysis
    362356 (Cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    362356 (Cul1)
   04340 Hedgehog signaling pathway
    362356 (Cul1)
   04350 TGF-beta signaling pathway
    362356 (Cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    362356 (Cul1)
   04114 Oocyte meiosis
    362356 (Cul1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    362356 (Cul1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362356 (Cul1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    362356 (Cul1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     362356 (Cul1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 362356
NCBI-ProteinID: NP_001102097
RGD: 1308157
Ensembl: ENSRNOG00000005310
Vega: OTTRNOG00000001405
UniProt: B1WBY1
LinkDB
Position
4q24
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcaaacaggagtcagaatcctcatggactgaagcagatcggtcttgaccagatc
tgggatgacctcagagctggaattcagcaagtgtacaccagacaaagcatggcaaagtcc
agatacatggagctctacactcatgtttataactactgtactagtgtgcatcagtccaac
caagcccggggtgctggagtccctccttccaagtcaaaaaaggggcagactcctggggga
gctcagtttgtcggcttggagttatacaagcgattgaaggagtttttgaagaattacttg
acaaatcttcttaaggatggagaagatttaatggatgagagtgtgctgaagttctacact
cagcagtgggaagattaccgattctccagcaaagtgctgaatggaatctgtgcctacctc
aatagacattgggttcgtcgcgaatgtgatgaaggacgaaaaggaatatatgaaatctat
tcgcttgcgttggtgacatggagagattgtttgttcaggccattgaataaacaggtaaca
aatgctgttttaaaactgattgagaaggaaagaaatggcgaaaccatcaatacaagactg
attagtggagttgtacaatcttatgtggaattgggactgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagaaagtactgaattcttacagcagaacccagttactgaatat
atgaaaaaggctgaagctcgtctgcttgaggaacagcggagagttcaggtttatctccat
gagagcacacaagatgagctagcacggaaatgtgagcaggtcctcattgaaaaacacttg
gaaatttttcacacagagtttcagaatttgttggatgctgacaagaatgaagatttgggc
cgcatgtataatcttgtatctagaattcaggatggcctaggagaattgaaaaaactacta
gagacacatattcataatcagggtcttgcggcaattgagaagtgtggagaagctgctctg
aatgaccccaagatgtatgtgcagacagtgctggatgttcataaaaaatacaatgccctg
gtgatgtcagcattcaacaacgatgctggcttcgtggctgcacttgataaggcttgtggt
cgcttcataaacaacaatgcagttaccaaaatggcccagtcatccagtaaatcccctgag
cttcttgctcggtactgtgactccttgttgaagaaaagttctaagaacccagaagaggca
gaactagaagataccctcaatcaagtgatggtggtcttcaagtacatcgaggacaaagat
gtatttcagaagttctatgcaaagatgcttgccaagagactggtacatcagaacagtgcg
agtgacgatgctgaagcaagcatgatctctaaattaaagcaagcttgtggttttgagtac
acttccaaactccagcgaatgtttcaagacattggtgtaagcaaagatctaaatgaacag
ttcaaaaagcacctgacgaattcagaaccactggacttggacttcagtattcaggtcctg
agttccggatcatggccctttcagcagtcttgcacgtttgccttgccgtcagagttggag
cgcagttaccaacggtttacagctttctacgccagccgtcacagtggcagaaaattgaca
tggttgtatcaactgtccaaaggggaactagtcactaactgcttcaaaaacagatacact
ttgcaggcgtccacattccagatggccatcctgcttcagtacaacacagaagacgcctat
actgtgcagcagctgaccgacagcactcagattaaaatggacattttggcacaagtccta
cagattttactgaagtcaaaattgctggtcttagaagatgaaaatgccaatgttgatgag
gtggaattgaagccagacaccttaataaagttatatcttggttataaaaataagaaattg
agggttaatatcaatgtaccaatgaaaactgaacagaagcaggaacaagaaaccacacac
aaaaatatagaggaagaccgcaaactactgattcaggcggccatcgtaagaatcatgaaa
atgaggaaggttctgaaacaccagcagttacttggtgaagtcctcactcagctgtcctcc
aggttcaaacctcgggtcccagtgatcaagaaatgcattgatattctcatcgaaaaagaa
tatttggagcgagtcgatggtgagaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system