KEGG   Rattus norvegicus (rat): 362831Help
Entry
362831            CDS       T01003                                 

Gene name
Dot1l
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    362831 (Dot1l)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    362831 (Dot1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    362831 (Dot1l)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     362831 (Dot1l)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     362831 (Dot1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 362831
NCBI-ProteinID: NP_001102203
RGD: 1306644
Ensembl: ENSRNOG00000032546
UniProt: D3ZCP0
LinkDB All DBs
Position
7q11
AA seq 1549 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYVSVLAENPGDKHHDAAHEIIETIRWVCEEIPDL
KLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHIL
QQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVL
QVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRER
IANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIM
RVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKS
NATTPTKVPESKAAATEAPADSGAEEEKSGVATVKKQSPSKARKKKLNKKGRKMAGRKRG
RPKKMSAASADRKSKKSQSTLDLLHSPPPAPPSASPQDAYRAPHSPFYQLPPSTPLHSPD
PLLVAPTPPALQKLLESFKIQYLQFLAYTKTPQYKANLQQLLDQEKEKNTQLLGTAQQLF
SHCQAQKEEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEKDNSELR
SQSLRLLRARCEELRLDWSTLSLENLRKEKQALRSQISEKQRHCLELQISIVELEKTQRQ
QELLQLKSCVPPDDALSLHLRGKGALGRELESDAGRLRLELDCAKLSLPHLSSMSPELSM
NGHAASYELCGAASRPSSKQNTPQYLASPLDQEVVPCTPSHSGRPRLEKLSGLALPDYTR
LSPAKIVLRRHLSQDHTGASKAATSEPHPRPEHAKENSLPYQSPGLSNSMKLSPQDPPLA
SPATSPLTSERGSEKGVKERAYSSHGETITSLPVSIPLSTVQPNKLPVSIPLASVVLPSR
AERARSTPSPVPQPRDSSSTLEKQIGASTHGAGGAAAGSRSLTVAPTGFYAGSVAISGAL
ASSPAPLASGMESAVFEESSGPSSLFGTMGSRSTPPQHPPLLPQSRNSGPASPAHQLAAS
PRLSVTTQGSLPDTGKGELPADPAFSDPESEAKRRIVFSISAGASSRQSPSTRHSPLTSG
TRGDCVQSHGQDSRKRSRRKRASAGTPSLTTGVSPKRRALPTVAGLFTQSSGSPLNLTSM
VSNINQPLEITAISSPESSLKSSPTPYQDHDQPPVLRKERPLGPTNGAHYSPLTSDEEPG
SEDEPSSARIERKIATISLESKSPPKTLENGGGLVGRKPVPSGEPVNSSKWKSTFSPISD
LGLAKAMDSPLQASSALSHSPLFSFRPSLEEPAAEAKPSTHPRKSFAGSLAAAEGPSPGT
NPPNSLAFSGGLAADLGLHSFNDGASLSHKGPEVAGLSASLSFPSQRGKDSTTEANPFLS
RRQPEGLGGLKGEGNASKESGESLPLCGPSDKVSLPHGSRASKGRDRELDFKGGHNLFIS
AAAVPPGGLLGGPGLVTVASSAGSATPSAQAPRPFLSTFAPGPQFTLGPMSLQANLGSVA
GSSVLQSLFSTVPAAAGLVHVSSTATRLTNSHTMGSFSSGVAGGTVGGN
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagaagctggagctgaggctcaagtcgcctgtgggcgcggagcccgccgtctac
ccgtggccgctgccggtctacgtgagtgtacttgcggagaacccgggggacaagcaccat
gatgctgctcatgagattatcgagactatccgatgggtctgcgaggaaatcccagatctc
aagctggccatggagaactatgtcctgatcgactacgacaccaaaagttttgaaagcatg
cagaggctgtgtgacaaatataaccgggccattgacagcatccaccagctgtggaagggc
actacacagcccatgaagctcaatactcggccgtccaatgggctcctgcggcacatcctg
cagcaggtgtacaaccactctgtgaccgacccagagaagctcaacaactacgagcccttc
tcccccgaggtgtacggggagacctcctttgacctggtggcccagatgatcgatgagatc
aagatgaccgaggatgacctgtttgtagacctgggcagtggtgtggggcaggttgtcctt
caggttgcggcggccaccaactgcaaacatcactacggagtggagaaagcggacatccca
gccaagtacgcggagaccatggatcgagagttcaggaagtggatgaaatggtatggaaaa
aagcatgcagaatacacactggagcgaggtgacttcctctcagaggagtggagggaacgg
atcgccaacacgagtgttatatttgtgaataactttgcctttggtcctgaggtggatcac
cagctgaaggaacgattcgcaaacatgaaggaaggcggcagaatcgtatcctcaaagccc
tttgcccctctgaacttcaggatcaacagcaggaacttgagtgacattggcaccatcatg
cgtgtggtggagctgtcgcccctgaagggctctgtgtcatggactggcaagcctgtctcc
tactacctgcacaccattgaccgcaccatacttgaaaactatttttctagtctgaaaaat
ccaaaactcagggaggagcaggaggcagctaggcgcaggcagcagcgagagaacaagagc
aacgcgaccacacccaccaaagtccctgagagcaaggcagctgccaccgaggcccctgcg
gattctggtgctgaggaagaaaaatcaggtgtggccaccgtcaaaaagcaatctccctcc
aaagcccggaagaagaaactgaacaagaaagggagaaaaatggctggccggaagcgtggg
cgacccaagaaaatgagtgctgccagtgccgatcgcaagtccaagaagagccaaagcaca
ctggatctcctgcactctccgcccccagccccaccctcagcctcaccccaggatgcatac
agggccccccacagcccgttctaccagctacctccgagcacgccgctgcactcgcccgac
ccactgctagtggctcccaccccacccgcgctgcagaagctgttagagtccttcaagatc
cagtacctgcagttcctggcctacacgaagaccccgcagtacaaggccaacctgcagcag
cttctggaccaggagaaggagaagaacacacaactgctgggtacagcccagcagctcttc
agccattgccaggcacaaaaggaagagatccgcaggctgttccagcagaagctggatgag
ttgggcgtgaaggcactgacctacaatgacctgattcaggcccagaaggaaatctctgcc
cacaaccagcagctgcgggagcagtcggaacagctggagaaggacaacagcgagcttcgg
agccagagcctgcggctgctcagggcccggtgcgaagagctgaggcttgactggtccacc
ttgtccctggagaacctgcggaaagagaagcaggccctgcggagccagatctcagagaag
cagcggcactgcctagagctgcagatcagcatcgtggagctggagaagacccagcgccag
caggagctcctgcagttgaagtcctgtgtgccaccagatgacgctctgtccctgcacctg
cgtggcaagggtgccctgggccgcgagctggagtctgacgctgggcgcttgcgccttgag
ctggactgtgccaagctctccctcccacacctcagcagcatgagccctgagctgtccatg
aatggccatgccgccagctatgagctctgcggtgcagctagtcggccctcgtccaagcag
aacaccccccagtatctggcctcccccttggaccaggaggtcgtgccctgcacccctagc
cacagtggccggcctcggctggagaagctgtctggcctggctttgcctgactacacccgg
ttgtcaccggccaagattgtgttgaggcggcacctgagccaggaccacaccggggccagc
aaagcagctactagtgagccacaccctcggccagagcatgccaaggagaacagccttccc
taccagagccctggcttgtcgaacagcatgaagctcagcccccaggatccaccgctggcc
tccccggcaacctcacccctcacttccgagaggggtagtgagaagggtgtaaaggagcgt
gcctacagcagccatggggagaccatcaccagcctgcctgtcagcattccactcagcaca
gtacagcccaacaagctgcctgtcagcatcccgctagccagcgtggtgctgcccagccgt
gccgagagggcgaggagcactcccagccctgtgccccagcctcgagactcctcatccaca
cttgagaagcagattggtgcttccacccatggtgcagggggtgctgcggcaggaagcagg
agcctcactgtggcgcccacaggtttctatgctggttcggtggccatcagtggggctctg
gccagcagcccagcacctctggcctctggaatggaatctgctgtttttgaggagtcctct
ggccccagcagcctctttggcaccatggggtctcgcagcacaccgccacaacatccacct
ctcctgccgcagtctcgcaactcgggccctgcctctcctgcccaccagctcgcagccagt
ccccgcctgagtgtgaccacccagggctcactgccagacaccggcaaaggggagctgcct
gctgatcctgccttctcagacccagagagtgaagctaagaggaggattgtgttcagcatt
tcagctggtgccagctccaggcagtcgccttccaccaggcacagccccttgacctctggc
acccgtggggattgtgttcagagccatgggcaggacagtcgtaagcgtagcagaaggaag
cgtgcatcagctggaacgcctagcctcaccacgggtgtgtcccccaagcgccgagctctg
ccaaccgtcgctggcctctttacacagtcttcggggtcgcctctcaatctcacctccatg
gtcagcaacatcaaccagcccctggagatcacagccatctcatccccggagagctcactg
aagagctcccccacaccctaccaggaccatgaccagcctccagtgctcaggaaggagcgg
cccctgggcccaactaatggggcccactactctccgctgacgtcagatgaggagccaggc
tcggaggacgagcccagcagtgcccgaattgagagaaaaattgcaacaatctctttagaa
agcaaatctcccccgaagacactggaaaatggtggtggcttagtgggaaggaagccggtc
ccctcaggcgagcctgtcaacagcagcaaatggaagtccaccttctcacccatctccgac
ctcggcttggccaaggccatggacagtccgctacaggccagctctgcactgagccacagc
cccctcttctctttccggccgtccttggaggagcctgctgctgaggccaagccctccacc
cacccaaggaaaagttttgcgggctctctggctgcagctgaggggccaagccctggcacc
aaccctcccaacagcctggccttcagtgggggccttgctgcagacctcggtttacatagc
ttcaatgacggtgcttccctctcccacaagggcccggaggtggcgggcctgagcgcctcc
ctgagcttcccatcccagaggggcaaggacagtaccacagaggccaaccccttcctcagc
aggcggcagccggagggcctgggtggcctgaagggtgagggcaatgcaagcaaggagtca
ggagagagcctgcccctgtgtgggccctcagacaaggtctcactgccacacggcagcagg
gccagcaaaggccgtgaccgcgagctggacttcaagggcggccacaacctcttcatctct
gctgcagccgtgcctccaggtggcctccttggtggccctggtcttgtaactgtggcttcc
tctgcgggcagtgcgacaccctctgcccaggctccccggcctttcctgagcacctttgcc
cctgggccccagtttactctgggccccatgtccctgcaggccaacctgggctctgtggcc
ggctcctctgtgctgcagtccttgttcagcactgtgccagctgctgcaggcctggtgcat
gtgtcatccactgcgacccgactgaccaactcacacaccatgggcagcttctcctctggg
gtggccggcggaaccgttggaggtaattag

DBGET integrated database retrieval system