KEGG   Rattus norvegicus (rat): 363287Help
Entry
363287            CDS       T01003                                 

Gene name
Hdac4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04371  Apelin signaling pathway
rno05034  Alcoholism
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    363287 (Hdac4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    363287 (Hdac4)
  09164 Substance dependence
   05034 Alcoholism
    363287 (Hdac4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    363287 (Hdac4)
   05165 Human papillomavirus infection
    363287 (Hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    363287 (Hdac4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     363287 (Hdac4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     363287 (Hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 363287
NCBI-ProteinID: NP_445901
RGD: 619979
Ensembl: ENSRNOG00000020372
UniProt: Q99P99
LinkDB All DBs
Position
9q36
AA seq 1077 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPAAVPMDLRLDHQFSLP
LEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLN
KKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVATALKKRPLDVTDSACSSAPGSGPS
SPNSSSGNVSTENGIAPTVPSTPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPAT
GPAAGAAGQQDAERLALPALQQRISLFPGTHLTPYLSTSPLERDGGAAHNPLLQHMVLLE
QPPTQTPLVTGLGALPLHTQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLV
IQQQHQQFLEKHKQQFQQQQLHLSKMISKPSEPPRQPESHPEETEEELREHQALLDEPYL
DRLPGQKEPSLAGVQVKQEPIESEEEEVEATREAEPSQRPATEQELLFRQQALLLEQQRI
HQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLM
LKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLL
YGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVAT
GELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGT
QQAFYNDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEY
LAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGR
IVLALEGGHDLTAICDASEACVSALLGNELEPLPEKVLHQRPNANAVHSMEKVMGIHSEY
WRCLQRLSPTVGHSLIEAQKCENEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagcctgtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggacgtggctacagcgctgcctctg
caggtggcccctgcagcagtacccatggacctgcgcttggaccaccagttctcactgccc
ttggaacctgcactgcgggagcagcaactgcagcaggaactcctagcactgaagcagaag
cagcagatccagcggcagatcctcattgcagagttccagcgtcagcatgagcagttgtcc
cgacagcatgaggcacagctgcatgaacatatcaagcagcagcaggagatgctggccatg
aagcaccagcaggagctgctggagcaccagcggaaactggagcggcaccggcaagagcag
gagctggagaagcagcaccgtgagcagaagctgcagcagctcaagaacaaggagaagggc
aaagagagtgctgtggcgagcacagaggtgaagatgaagctgcaggagtttgttctcaac
aagaagaaggctctggcccaccggaacctgaaccactgcatgtccagcgacccccgctac
tggtatgggaagacacagcacagctcccttgaccagagctctccaccccagagtggggtg
tcagcctcctacaaccaccctgtcttgggaatgtacgacgccaaagatgacttccctctt
aggaaaacagcttctgaacctaacctgaaattacggtcaaggcttaagcagaaagtagct
gagagacggagcagccccctgctgcgcaggaaagatggccctgtggccactgctctaaaa
aagcgacccctggatgttacagactccgcatgtagcagcgcccctggctccggtcccagc
tcccccaatagcagctctggcaacgtcagcaccgagaatggcattgcacccaccgtgccc
agcactccagctgagacgagcttggcacacagacttgtgactcgagaaggctctgttgcc
ccacttcctctctatacatcaccatccttgcccaacatcaccctgggacttcctgccact
ggccctgctgctggtgcagcaggccagcaggatgctgagaggcttgctctcccagccctc
cagcagcgaatctccttgttccctgggacccacctcaccccatacctgagcacctcgccc
ctggagcgggacggtggagcagctcacaaccccctcctgcagcacatggtcctgctggag
cagccacccacccagacgccccttgtcacaggcctgggggcactgcccctccacacacag
tccctggttggtgcggacagggtgtccccatccattcacaagctgcggcagcaccgacct
ctggggcgcacgcagtcagcacccctgccgcagaacgcacaggccctgcagcacctggtg
atccagcagcagcaccagcagtttctggagaagcacaagcaacagttccagcagcagcag
ctgcacctcagcaagatgatttctaaacccagtgagccacctcggcagcctgagagccac
ccggaggagacagaggaggagctccgtgaacaccaggccttgctggatgagccctaccta
gatcggctccctgggcagaaggagccctccttagctggtgtgcaggtgaagcaggagccc
atcgagagtgaggaggaagaagtagaggccactcgagaggcggaacccagccagcgccca
gccactgaacaggagcttctctttagacagcaagctcttctgctggagcagcagaggatc
caccagttaaggaactaccaggcatctatggaggctgctggcatccctgtgtcatttggc
agccacagacctctgtctcgcgcacagtcctccccagcatctgccaccttccccatgtca
gtccaggagccccccaccaaaccaaggttcaccacaggccttgtgtatgacacactcatg
ttgaagcaccagtgcacctgtgggaacaccaacagccacccggagcatgctgggaggatc
cagagcatctggtcccgcctgcaggagactggcctccgtggcaagtgtgagtgcatccgc
ggacgcaaggccacactggaagagctgcagacagtgcactcggaggcccacacactcctc
tatggcacaaaccctctcaacagacagaaactggacagctcgctgacctccgtgtttgtc
aggcttccttgtggtggtgttggggtggatagtgataccatatggaatgaggtgcactcg
tctggggcagcccgcctggctgtaggctgtgtagtggagctggtcttcaaggtggccacg
ggagagctaaagaatggctttgctgtggttcgtcccccaggacaccatgccgaggagagt
acacccatgggtttctgctactttaattctgtggcaattgcagccaaacttctccagcag
aggttgaatgtgagcaagatcctcattgtagactgggatgtgcaccatgggaatgggacc
cagcaggccttctacaatgaccccaatgttctctacatgtccctgcaccgctatgacgat
gggaacttcttcccaggaagtggagcaccagatgaggtgggcacagggccaggcgtgggt
ttcaatgtcaacatggccttcacgggtggcctcgatccccccatgggagacgccgagtac
ctggcagccttcagaacggtggtcatgccaatcgcaaatgagtttgccccagatgtggta
ctggtgtcctcgggcttcgatgctgtggagggccaccccacacctcttggagggtacaat
ctctctgccaaatgtttcgggtacttgacaaaacagctgatgggcttagctggtggccgg
atcgtgctggccctggagggaggccatgacctgacagccatctgtgatgcttctgaagca
tgtgtttctgctctgctgggaaatgagcttgagcctctgccagaaaaggttctacatcag
agacccaatgccaatgccgtccactccatggagaaagtgatgggcatccacagtgagtac
tggcgctgcctgcagcgtttgtcccccactgtggggcactctctgattgaggcgcagaag
tgtgagaatgaagaagctgagacagtcaccgccatggcctcgctgtctgtaggcgtcaaa
cctgctgagaagagatctgaggaggagcccatggaggaggagccaccactgtag

DBGET integrated database retrieval system