KEGG   Rattus norvegicus (rat): 364785Help
Entry
364785            CDS       T01003                                 

Gene name
Suv39h2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    364785 (Suv39h2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    364785 (Suv39h2)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     364785 (Suv39h2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     364785 (Suv39h2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    364785 (Suv39h2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 364785
NCBI-ProteinID: NP_001102353
RGD: 1306969
Ensembl: ENSRNOG00000015585
UniProt: D3ZIH5
LinkDB All DBs
Position
17q12.3
AA seq 481 aa AA seqDB search
MAAARAKARSGEARARCHRAPGPPQRPKPRRTTRRCRADTVTARRSRSSAGGRRAGSNRA
RSRAPRAAVFGGECARGASFKAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEV
EYLCDYKVVKGVEYYLVKWKGWPDSTNTWEPLWNLRCPQLLQQFSDDKNTYLSQGRKRKA
ITSKDNNKSLQPAVAEYIVQKARQRIALQRWQDYLNRRKNHKGMIFVENTVDLEGPPSDF
YYINEYRPAPGITLNSEATFGCSCTNCFFEKCCPAEAGVVLAYNKNRQIKIQPGTPIYEC
NSRCRCGPDCPNRIVQKGTQYSLCIFRTSNGCGWGVKTLVKIKRMSFVMEYVGEVITSEE
AERRGQLYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFSVFIDNLDT
RLPRIALFSTRTIKAGEELTFDYQMKGSGELSSDSIDYSPARKRVRTQCKCGAETCRGYL
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccagggccaaggcacggagcggtgaggccagagcgcggtgtcaccgggct
ccaggtccgccccagaggcccaaacccaggcgaacgacgagacgctgccgcgcggacacc
gtgacggcgcgacgctcgcggtcgtctgcgggcgggagacgcgccggctccaaccgagcg
aggtccagagctccgcgggccgcggtctttggcggcgagtgtgcacgaggtgcctcattc
aaggcctggtgtgtgccttgcctagtttcacttgatactctccaggaattatgtagaaaa
gaaaagctcacatgtaaatcgattggaatcaccaaaaggaatctaaacaattatgaggtg
gagtacttgtgtgactacaaggtagtaaagggtgtggaatattatcttgtaaagtggaaa
ggatggccagactctacaaacacctgggagcccttgtggaacctcaggtgcccacagctc
ctgcagcagttctctgacgacaagaatacttacttatcccagggaaggaaacgcaaggcc
atcacttcaaaagacaataacaaatccttgcaacctgcagttgctgagtatattgtacag
aaagctaggcaaagaatagctctgcagagatggcaagattacctcaacagaagaaagaac
cacaaagggatgatatttgttgaaaatactgttgacttagagggcccaccttcagacttc
tactacatcaatgaatacaggccagctcctgggatcaccttaaacagtgaagctaccttt
gggtgttcgtgtacaaactgcttctttgaaaagtgttgtcctgctgaagctggagttgtt
ttggcttataataagaaccgacaaattaaaatccaaccaggcactcccatctatgaatgc
aactcaaggtgccgatgtggacctgattgtcccaataggattgtacagaaaggcacacag
tattccctgtgcatctttagaactagcaatggctgtggctggggtgtaaaaacccttgtg
aagattaaaaggatgagttttgtcatggaatatgttggagaggtgatcaccagtgaagag
gctgagagacggggacagctctatgacaacaaagggatcacctacctttttgatctggac
tatgagtctgatgagttcacagtggatgcagctcgatatggaaatgtgtctcattttgtg
aatcatagttgtgacccaaatcttcaggtgtttagtgttttcatcgataaccttgatact
cggcttcccaggatagcattgttctccacaagaaccataaaggctggagaagagctgact
tttgactatcaaatgaaaggttctggagaactgtcttcagactctattgactacagccct
gccagaaaaagggtcagaacccaatgcaaatgtggagctgagacgtgcagaggttacctc
aactga

DBGET integrated database retrieval system