KEGG   Rattus norvegicus (rat): 367562Help
Entry
367562            CDS       T01003                                 

Gene name
Gaa
Definition
(RefSeq) glucosidase, alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    367562 (Gaa)
   00500 Starch and sucrose metabolism
    367562 (Gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    367562 (Gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    367562 (Gaa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     367562 (Gaa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   367562 (Gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 367562
NCBI-ProteinID: NP_954549
RGD: 735227
Ensembl: ENSRNOG00000047656
UniProt: Q6P7A9
LinkDB All DBs
Position
10q32.3
AA seq 953 aa AA seqDB search
MNIRKPLCSNSVVGACTLVSLTTAVILGHLMLRELMLLPQDLHESSSGLWKTYRPHHQES
YEPAPLHIQEHAEQLRAVPTQCDVTPNSRFDCAPDKGITQEQCEARGCCWVPAGQVLNGP
VMGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLH
FMIKDPTSKRYEVPLETPRVLSQAPSPLYSVEFSEEPFGVIVRRKLGGRVLLNTTVAPLF
FADQFLQLSTSLPSQHIAGLGEHLSPLMLSTEWTRITLWNRDVAPSQGVNLYGSHPFYLA
LEDGGLAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDG
FADFPDMVHELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWIDMNEPSNFIRGSQQGCPDNELEN
PPYVPGVVGGALQAATICASSHQFLSTHYNLHNLYGLTEAIASSRALVKTRGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEHLAYSVPEILQFNLLGVPLVGADICGFQGNTTEELCVR
WTQLGAFYPFMRNHNDLNSLPQEPYRFSETAQQAMRKAFTLRYALLPYLYTLFHGAHVKG
DTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTDVTGYFPKGMWYNLQMVPV
ETLGSLPSSSPASSFRSIVHSKGQWLTLEAPLDTINVHLRAGYIIPLQGPSLTTTESRKQ
PMALAVALTESGEASGELFWDDGESLGVLERGAYTLVTFSAKNNTIVNKLVHVTKEGGEL
QLREVTILGVTTAPTQVLSNGISVSNFTYSPDDKSLSIPVSLLMGERFQIDWS
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacggaagcccctctgttccaactccgtggttggggcctgcaccctcgtctcc
ttgactacggctgtcatcctgggtcacctcatgctccgggagctaatgctactcccccag
gatcttcatgagtcctcctcgggactgtggaagacttaccgacctcaccatcaggaaagt
tacgagccagcgcccctgcacatccaggagcacgccgaacagctaagagcagtacccaca
cagtgtgatgtaacccccaacagccgctttgactgtgcccccgacaaaggcatcacccag
gagcagtgcgaggcccgaggctgctgctgggtcccagcagggcaggtgctgaatgggcca
gtgatggggcagccctggtgtttcttccctcccagctacccaagctaccggctagagaac
ctgagctctacagagtcagggtacacagccaccctgacccggaccagtccgaccttcttt
ccaaaggatgtgctgaccttacagctggaggtgctgatggagactgacagccgcctccac
tttatgatcaaagatcccactagtaagcgctacgaagtgcccctggagaccccgcgtgtc
ctgagccaggcgccatccccactttacagtgtggagttctcagaggagcccttcggcgtg
atcgttcgcaggaagcttggtggccgagtgctgctgaacacaaccgtggcccccctgttc
ttcgctgaccagttcctgcagctgtccacctcactgccctcccagcacatcgcaggcctg
ggtgagcacctcagtccactcatgctcagcaccgaatggactcgcatcaccctctggaac
cgggatgtggcaccctcgcaaggtgtcaacctctatgggtcacaccctttctacctggca
ctggaggacggtggcttggctcacggtgtcttcttgctaaatagcaatgccatggatgtg
gtcctgcagcccagcccggccctaacttggaggtcaacaggcggaatcctggatgtttat
gtgttcctaggcccagagcccaagagtgttgtccaacaatacctggatgtcgtgggatac
cccttcatgcctccgtactggggcctgggcttccacctctgccgctggggctactcctcc
accgccatcgtccgacaggtggtggagaacatgaccaggacgcacttccccctggacgtg
cagtggaatgacctggactacatggacgcccggagagacttcactttcaaccaggacggc
tttgcagacttcccagacatggtgcacgagctccaccagggtggccggcggtacatgatg
attgtggaccctgccatcagcagttcaggccctgctgggagttacaggccctatgatgag
ggtcttcggaggggcgtgttcatcaccaatgagactgggcagccattgattgggaaggtt
tggcctggatccaccgccttccctgatttcaccaaccctgagaccctcgactggtggcag
gacatggtgtctgagttccatgcccaggtgcccttcgatggcatgtggatcgacatgaac
gaaccgtccaacttcatcagaggctctcagcagggctgccctgacaatgaactagagaac
cccccctatgtgcccggggtggttggcggggccttgcaggccgccaccatctgtgcctcc
agccaccagttcctctctacacactacaacctccacaacctatacggcctcactgaagca
attgcctccagcagggccctagtcaagactcggggaacacgaccctttgtgatctcccgc
tcaacctttgcgggccacggccggtatgccggtcactggacaggggacgtgtggagctct
tgggagcatcttgcgtactctgtgccagaaatcctgcagtttaacctgctgggcgtgccc
ctggtcggggcagacatctgcggcttccagggaaacacgacagaagagctgtgtgtgcgc
tggacccagttgggggccttctaccccttcatgcggaaccacaatgacctgaatagcttg
cctcaggagccgtacaggttcagcgagacggcacagcaggccatgaggaaggccttcacc
ttgcgctatgcccttctaccctacctgtatacactcttccacggcgcccacgtcaaaggg
gacacggtggcccggcccctcttcctggagttccctgaggatcccagcacctggtctgtg
gaccgccagctcttgtgggggccggccctgcttatcacacctgtgcttgaacctgggaaa
actgacgtgacaggctacttccccaagggcatgtggtacaacctgcagatggtacctgtg
gagacccttggtagcctcccttcttcgtcaccagcctcgtctttcagatctattgtccac
agcaagggtcagtggctgacactggaagcccccctggataccatcaacgtgcacctcagg
gcggggtacatcataccactgcagggtcccagcctcacaaccacagagtcccgaaagcag
cccatggccctggctgtggcgttaactgaaagcggcgaggcctctggggagctgttttgg
gacgacggggagagcctcggggttctggagcgtggggcctacacactggtcaccttctca
gccaagaataataccattgtaaacaagttagtgcacgtgaccaaggagggaggtgaactg
caactgagggaggtgaccatcttgggagtgaccacagctcccacccaggtcctttccaat
ggcatctctgtctccaatttcacctacagcccggacgacaagagcctgtccatccctgtc
tcactgctgatgggagagcggtttcaaatcgattggtcctag

DBGET integrated database retrieval system