KEGG   Rattus norvegicus (rat): 405057Help
Entry
405057            CDS       T01003                                 

Gene name
Olr1421
Definition
(RefSeq) olfactory receptor 1421
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 405057
NCBI-ProteinID: NP_001000780
RGD: 1333061
Ensembl: ENSRNOG00000050694
UniProt: D3ZF09
LinkDB All DBs
Position
10q22
AA seq 320 aa AA seqDB search
MGIITCVNNYTGLSDFTLVGFLSQSKDPVLLAVLIFVVFLMALSGNALLILLILSDTHLH
TPMYFFIGQLSLMDMMYISVTVPKMLMDQVLGSHKISAAACGMQMFLYLTLAGSECLLLA
AMSYDRYVAICHPLRYPILMNHRVCLLLLSVCWLLGSLDGFIFTPVTMTFPFCGSRKIYH
FFCEVPAVTKLSCSDTWLYETFMYVCCVIMLLIPVTVISGSYLSILLTVLRMNSTEGRKK
ALATCSSHMMVVILFYGAAVYNYMLPISFHTPEKNMVVSAFYTILTPLLNPLIYSFRNKN
VNKALSKLLDVSTIFQKTVK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcatcacctgtgtgaacaactacactggactatcagatttcaccctggtggga
ttcttaagtcaatccaaagaccctgtcctgcttgctgtgctcatatttgtggttttcctg
atggccttgtctggaaacgcccttctgatcctgctgatactctctgacacccacctccac
acacccatgtacttttttatcggtcagctgtccctcatggacatgatgtacatttctgtc
actgtgcccaagatgctcatggaccaggtgctggggagccacaagatctcagctgctgcc
tgtgggatgcagatgttcctctacctgacactagcaggttctgaatgtttgcttctggct
gccatgtcctatgaccgctatgtggccatctgccatccactccggtatcctatcctcatg
aaccacagggtgtgtctccttctgttgtctgtctgttggctcctgggatccttggatggc
ttcatattcacccctgtcaccatgacattcccattctgtggatcacggaagatctatcac
ttcttctgtgaggttcctgctgtgacaaagctctcctgctcagacacctggctctatgag
accttcatgtatgtgtgctgtgtgatcatgcttctcattcctgttacagtcatttcagga
tcctacttatccatcctcctcactgttctgaggatgaactcaacagagggcaggaagaag
gctcttgccacctgctcctcccatatgatggtggtcatcctcttctatggagctgctgtc
tataactacatgctacctatctcgttccacacccctgagaagaacatggtggtgtctgca
ttttacaccatactcacacctctgttgaacccactaatctacagttttaggaataagaat
gtcaataaggctttgagtaaattgttagatgtaagcaccatcttccaaaaaactgtaaag
taa

DBGET integrated database retrieval system