KEGG   Rattus norvegicus (rat): 414785Help
Entry
414785            CDS       T01003                                 

Gene name
RT1-M6-1, RT1-M6
Definition
(RefSeq) RT1 class I, locus M6, gene 1
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules (CAMs)
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    414785 (RT1-M6-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414785 (RT1-M6-1)
   04145 Phagosome
    414785 (RT1-M6-1)
  09143 Cell growth and death
   04218 Cellular senescence
    414785 (RT1-M6-1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414785 (RT1-M6-1)
   04612 Antigen processing and presentation
    414785 (RT1-M6-1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414785 (RT1-M6-1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414785 (RT1-M6-1)
   05330 Allograft rejection
    414785 (RT1-M6-1)
   05332 Graft-versus-host disease
    414785 (RT1-M6-1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414785 (RT1-M6-1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414785 (RT1-M6-1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414785 (RT1-M6-1)
   05170 Human immunodeficiency virus 1 infection
    414785 (RT1-M6-1)
   05168 Herpes simplex virus 1 infection
    414785 (RT1-M6-1)
   05163 Human cytomegalovirus infection
    414785 (RT1-M6-1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414785 (RT1-M6-1)
   05169 Epstein-Barr virus infection
    414785 (RT1-M6-1)
   05165 Human papillomavirus infection
    414785 (RT1-M6-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414785 (RT1-M6-1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414785 (RT1-M6-1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414785 (RT1-M6-1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414785 (RT1-M6-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 LapA_dom
Motif
Other DBs
NCBI-GeneID: 414785
NCBI-ProteinID: NP_001008852
RGD: 1598232
Ensembl: ENSRNOG00000022107
UniProt: Q6MFY2
LinkDB All DBs
Position
20p12
AA seq 330 aa AA seqDB search
MGAPVLHATLLLLSAFLALTQTKNQSFAGSHFMQYLVTTTSSQPGLQDSHVCIVGHVDYM
PFMRFDSDGAAQRIQTRGPWMKQMGPEYLEMERKNAEGYSHRARENLRFAIQVYNQSDKA
HYSHAFDGQHYISLNSDLTTWSVGDSTAQITKRRWEADGVAEALSHFLKVSCVEHLQKHL
ETGKETLQRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVE
TRPAGDGTFQKWASVVVPNGEEQKYTCLVEHEGLPEPLTLRWKPATWPVVGITVGVVLLG
FVIIGALIAIVTMRKKRADPVDPVDLMDPV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggggctccagtgctgcatgctaccctactgctgctctcagccttcctggctctgacc
caaaccaagaaccagagttttgctggttcacacttcatgcagtatttggtaaccaccacc
tcgtctcaacccggtcttcaagattcgcatgtctgcattgttggccatgtggactacatg
ccatttatgcgctttgacagtgatggagctgctcagaggatccagacgagagggccttgg
atgaagcagatggggcctgagtatttggaaatggagagaaagaatgcggaggggtattca
cacagggctcgagaaaacctgcgattcgcaatccaagtctataaccagagcgataaagcg
cactatagccatgcttttgacggccaacattacatcagcctgaactcggacctgacaaca
tggagtgtgggagacagcacagctcagatcaccaagcgacggtgggaggcagatggtgta
gcagaggccttgagtcacttcttgaaagtctcttgtgttgaacacctgcagaagcacttg
gagacagggaaggagactctacagcgctcagatcccccaaaggcacatgtgacccttcac
cccagacctgaaggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgac
atcaccctgacctggcagttgaatggggaggacctgacccaggacatggagcttgtggag
accaggcctgcaggggatggaaccttccagaagtgggcatctgtggtggtgcctaatggg
gaggagcagaagtacacatgccttgtggagcatgaggggctgcctgagcccctcacactg
agatggaaaccagcaacttggcctgtggttggaataactgttggtgtagttctccttggg
tttgtcatcattggagctctgattgccattgtgaccatgaggaagaagagagcagaccct
gtggatcctgtggaccttatggatccagtgtga

DBGET integrated database retrieval system