KEGG   Rattus norvegicus (rat): 498012Help
Entry
498012            CDS       T01003                                 

Gene name
Ace3, RGD1561299
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 3
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
rno04924  Renin secretion
rno05142  Chagas disease (American trypanosomiasis)
rno05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    498012 (Ace3)
   04614 Renin-angiotensin system
    498012 (Ace3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    498012 (Ace3)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    498012 (Ace3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     498012 (Ace3)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M2
   498012 (Ace3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   498012 (Ace3)
CD molecules [BR:rno04090]
 Proteins
  498012 (Ace3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 498012
NCBI-ProteinID: NP_001245166
RGD: 1561299
Ensembl: ENSRNOG00000007467
Vega: OTTRNOG00000002215
UniProt: M0RB66
LinkDB All DBs
Position
10q32.1
AA seq 737 aa AA seqDB search
MGFPWAFLLVLLYYGQPLPWPKTVGEPSLDEFYSEAQAKMFLQFYEQTARVVLNELMEAT
WNYVTNITKQNQENMLQKEVERSQFMLYFGTRARMFRIDHFQDLDVKRRLSKLRNIDKSA
LPVEDFQEFNRLLTYMKTAYGRAEVCLDEGPCMPLEPDLEEIMATSRDQKELLWAWQGWR
DAIGRQLRPVFEDYVHLSNKAAQYNGYKDMGALWRSKYESDTLEEDLEQLYKELQPLYLN
LHAYVRRSLYRYYGPELIDLRGPIPAHLLGNMWAQSWNNILDLVLPYPNKPPEDITKIMK
NQHWRPEKMFEEANLFFTSMGMLPAPPAFWMKSMMEKPVDGREVECHTSSWNFYRLNDFR
VKKCTEVTIGDLLSIFHQMGHIQYYLQCQNLSIIYQEGASPAFEEAVGSTITLSAFSHKY
LLTRGLLSQQHQDSEEEVNFLLSIALEKIAFIPFGYMIDLFRWKVFDGTIQKNAYNQEWW
SLRLKYQGLCPPVPRSEDDFDPGAKFHIPANMPYIRYFLSLVLQFQLHEVLCRASGHVGP
LHRCDIYNSKVAGKILGDFLKVGSSRPWQEVLKEITGKPNISTKALLTYFKPLLNWLVTE
NVKQGDILGWPDFSCSFEEKITKKMSFLGMKIEPDQAYLGQWVLLSMSFIMLCLILALGL
RLHYLERRSLDSDTVILSTPPYAYFLGIAMEPRQAARKQWLLLGLCFVLMLCCIGLLIKI
FIHHTRKPPWMKAEWQS
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggctttccctgggccttcctacttgtgctcctctattacgggcagcccttgccgtgg
cccaagactgtgggagagccaagcttagatgagttctacagtgaagcccaagcaaagatg
ttcctgcagttttatgagcaaacagcccgagttgtgttgaacgagctcatggaggccact
tggaactatgtcaccaatatcaccaagcaaaatcaagagaacatgctgcagaaggaggtg
gagaggtcccagttcatgttgtactttggcacccgggcccgcatgtttaggatagaccat
ttccaggacctggacgtgaagcgcaggctgagtaagctgcggaacatagacaagtcggcc
ttgcccgtggaggatttccaggagttcaacagacttcttacctacatgaagacagcatac
ggtagagctgaggtgtgcctggatgagggtccatgcatgcccctggaacctgacctcgaa
gaaatcatggccacctccagggaccagaaggagctgctgtgggcctggcagggctggcgg
gatgccattggtcggcaactccgccctgtctttgaggactacgtacatctcagcaacaag
gctgcgcagtataatgggtacaaagacatgggggctttatggcgatccaagtatgagtct
gataccctggaggaagacctggaacagctctataaggagctgcagccgctctacctgaac
cttcacgcctacgtgcgccgctcactgtaccgctattacgggcctgagctcattgacctg
cgggggcccatccctgctcacctcctggggaacatgtgggctcagtcctggaacaatatc
ctagatctggtcctgccctatccaaataaacctcctgaggatatcacaaagatcatgaag
aatcagcactggaggcctgaaaagatgttcgaagaggctaatttattctttacctccatg
ggaatgctgcccgccccacctgctttctggatgaaatctatgatggagaagccagttgac
gggcgggaagtggagtgccacacctcatcctggaacttctataggctcaatgacttcagg
gtaaagaagtgcaccgaggtgaccataggagacctgctctccatcttccaccagatgggc
cacatccagtactacttgcagtgccagaacctctctataatctaccaagaaggcgccagc
ccagccttcgaagaggccgtggggtcaaccatcaccctctcagccttctcccacaagtac
ctgctcaccagaggtctgctcagccaacagcaccaggattcagaggaggaggtcaacttc
ctgttgagcatcgccctggagaagatcgccttcatccccttcggctacatgattgacctg
tttcgttggaaggtctttgacggcactattcagaagaacgcctacaaccaggagtggtgg
agcctcaggttgaagtaccaaggcctgtgcccgcctgtcccccggtcggaagatgatttt
gacccaggtgccaagttccacatccctgccaatatgccctacatccggtacttcctcagc
ctggtgctgcagttccaactccatgaagtactgtgcagggcctcaggccacgtgggtcct
ctgcaccggtgcgatatctataactccaaggtcgcagggaagattctgggggatttcctg
aaggtgggctccagccggccctggcaggaggtcctaaaggagataactggaaagcccaac
atatccaccaaggccctcttgacctacttcaagccgctgctgaactggctggtgactgaa
aacgtgaagcaaggggacatccttggctggccagacttcagctgctcttttgaagaaaaa
atcacaaagaaaatgtcatttctgggtatgaagatagagcctgaccaggcatacctgggg
cagtgggtgttgctaagcatgagttttatcatgctctgcctcatcctggcactgggcctc
aggttgcactacttggaaagacggtcactggacagcgacactgtgatacttagcaccccg
ccctatgcctacttcctgggcatagcgatggaaccccgccaggcggcccgaaaacagtgg
ctcctactgggcctctgcttcgtccttatgctgtgctgtattggcctcctcattaagata
ttcatacaccacaccaggaagcctccatggatgaaagctgaatggcagagctga

DBGET integrated database retrieval system