KEGG   Rattus norvegicus (rat): 500690Help
Entry
500690            CDS       T01003                                 

Gene name
Map3k9, RGD1562149
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    500690 (Map3k9)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     500690 (Map3k9)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  MLK family
   500690 (Map3k9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr SH3_9 SH3_1 SH3_2 Pkinase_fungal DUF1476 OmpH GvpL_GvpF
Motif
Other DBs
NCBI-GeneID: 500690
NCBI-ProteinID: NP_001094342
RGD: 1562149
Ensembl: ENSRNOG00000007271
UniProt: A0A0G2JUN9
LinkDB All DBs
Position
6q24
AA seq 1077 aa AA seqDB search
MESSRSLLGCLASAAAAPPGEDATGAGAEEEEDEEEAAAELGSHATLPYWTAVFEYEAAG
EDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGTED
PSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWVGDEVAVKAARHDPDEDISQTIEN
VRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRVPPDILVNWAV
QIARGMNYLHDEAIVPVIHRDLKSSNILILQKVENGDLSNKTLKITDFGLAREWHRTTKM
SAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLA
LPIPSTCPEPFAKLMEDCWNPDPHSRPSFSSILDQLTTIEESGFFEMPKDSFHCLQDDWK
HEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNII
IHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLISNRS
SPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQK
ELTSGDEGLKSLVDGYKQWSSSAPNLGKGPRSSPALPGFTSLMEIEDEDSEGPGSGENHL
QHSPNQSYLCIPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRSGTHHRRCE
VALLGCGAVLAATGLGFDLLEAGKCQLLPPEEPEPPAREEKKRREGLFQRASRPRRSTSP
PSRKLFKKEEPMTLLGDPSASLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVEAP
PLTQCTQNPLVNVRVERFKRDPNQSLTPTHVTLTAPTQPSGHRRTPSDGALKPASVPPAL
GSRSPSSNGVSPGPGAGMLKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQRDSTLERPK
TLEFLPRPRPSANRQRLDPWWFVSPSHARSASPANSSSTETPSNLDSCFASSSSTVEERP
GLPALLPLQAGPLPPAERTLLDLDAEGQSQDSTVPLCRAELNAHGPSPYEIQQEFWS
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctccagatcgcttctcggctgcctggcgagcgccgctgcggccccgccgggg
gaggatgccaccggtgctggggccgaagaggaggaagacgaagaggaggcggcggccgag
ctgggatctcatgccacgctgccctactggacggctgtgttcgagtacgaggcggcagga
gaggacgagctgaccctgcggctgggcgatgtggtagaggtgctgtccaaggactctcag
gtgtccggcgatgagggctggtggaccggacagctgaaccagcgggtgggcatcttcccc
agcaactacgtgaccccgcgcagcgccttctccagtcgctgccagccgggcacggaggac
cccagctgctacccgcccattcagctgttggagattgattttgcggagctaaccctggag
gagatcatcggcattggaggctttgggaaagtctatcgtgctttctgggtaggtgacgag
gtggccgtgaaagcagctcgccacgaccctgatgaggacatcagccagaccatagagaat
gttcgccaagaggccaagctctttgccatgctgaaacacccgaacatcattgccctcaga
ggggtgtgcctgaaggaacccaacctctgcttggtcatggagttcgctcgtggagggcct
ctgaacagagtgttgtctgggaagagggttcccccggacatcctggtgaactgggccgtg
cagatcgccagagggatgaactacctacatgatgaggcgatcgtgcccgtcatccaccga
gaccttaagtccagcaacatactgatcctgcagaaagtggagaatggagacctgagtaac
aagactctgaagatcactgacttcgggctggcacgggaatggcaccggaccaccaagatg
agtgcggcggggacatacgcttggatggcgcctgaagtcatccgcgcttccatgttttcc
aagggcagcgatgtgtggagctatggagtactgctctgggaactgttgactggcgaggtg
cccttccggggcattgatggcttagcagtggcttacggtgtggcaatgaacaagctcgcc
cttcctatcccttctacctgcccagagccttttgccaaactcatggaagactgctggaat
cctgacccccactcacgtccatctttctctagtatcctggaccagctaacgactatagaa
gagtctggtttctttgagatgcccaaggactccttccactgcctgcaggatgactggaaa
catgagattcaggagatgtttgaccaactcagggccaaagaaaaggagcttcgaacctgg
gaagaagagctgacccgggctgcgctccagcagaagaatcaggaggagctgcttcggcgt
agggagcaggagctggctgagcgggagatcgacatcctggaacgagagctcaacatcatc
atccaccagctgtgccaggaaaagccccgggtgaagaaacgcaagggcaagttcaggaag
agccgactgaagctcaaggacggcaaccgcatcagccttccctcggatttccagcacaag
ttcacggtgcaggcctccccgaccatggataaaaggaagagtttgatcagcaaccgatcg
agtcctcctgcaagccccaccatcatccctcgccttcgagccattcagttgacaccaggt
gaaagtagtaaaacctggggccggagctcagttgttccaaaagaggaaggggaagaagag
gagaagagggccccaaagaagaaaggccggacgtggggaccagggacgcttggacagaag
gagctcacgtcaggagatgaaggcctcaagtccctggtagacggatacaagcagtggtca
tccagtgcccccaacctggggaagggcccgaggagtagccctgccctgcccgggttcacc
agccttatggagatagaggatgaggatagtgaaggcccaggaagcggagagaatcatcta
cagcattcacccaaccagtcctacctctgtatcccatttcctcgtggggaggatggggat
ggcccctccagtgatggaattcatgaggaacccaccccagtcaactcagctaccagtacc
cctcagctgacgccaactaacagcctcaagcgcagcgggacccaccaccggcgctgcgag
gtcgctctgctcggatgtggagctgttctggcagccacaggcctggggtttgacttgctg
gaagctggcaagtgccagttgcttcccccagaggaacctgagccaccagcccgggaggaa
aagaagaggcgagagggtcttttccaaagggccagtcgccctcgtcggagtaccagcccg
ccctcccgaaagctctttaagaaggaagagccgatgacgttgctaggagacccctctgcc
tccttgacactgctgtctctctcctccatctctgaatgcaactctactcgctccctactg
cgctctgacagtgatgagatcgtggtgtatgaaatgccagtcagcccagttgaagctcca
cccctaacccagtgcacccagaaccccctggttaatgtccgagtggagcgcttcaagaga
gaccccaaccagtccctgactcccacccacgtcaccctcacagcccccacacagcctagt
ggtcacaggcggactccttctgatggggcacttaaaccagcatcagtgcccccagccctg
ggcagcagaagcccctccagcaatggagtgagccctggtcctggagcaggcatgttgaaa
acccccagtcccagccgagacccaggcgaatttccccgtctccctgaccccaacgtggtc
tttcccccaactccgaggcgctggaacacacagcgagactctaccttagagagacccaag
acgctggagtttctgcctcggccacgtccttctgccaaccggcagcggctggacccttgg
tggtttgtgtcccccagccatgcccgcagcgcctccccagctaatagctccagcacagag
acacccagcaacctggactcctgctttgccagcagcagcagcactgtggaagagcggcct
ggactcccagccctgctccccttacaggcagggccactgccccctgctgagcggacactt
ctggacctggacgctgaggggcagagccaggatagcactgtgcccctgtgcagagctgaa
ctgaatgcacatgggccttctccatatgagatccaacaggagttctggtcttag

DBGET integrated database retrieval system